Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human TIMM8B Monoclonal Antibody | anti-TIMM8B antibody

TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2)

Gene Names
TIMM8B; DDP2; TIM8B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TIMM8B; Monoclonal Antibody; TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B; TIM8B; DDP-like Protein; DDPL; Deafness Dystonia Protein 2; DDP2); Anti -TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B; anti-TIMM8B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8E5
Specificity
Recognizes human TIMM8B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Applicable Applications for anti-TIMM8B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 0.3ug/ml
Immunogen
Full-length recombinant corresponding to aa1-83 from human TIMM8B (NP_036591) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(Western Blot analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody.|Lane 1: TIMM8B transfected lysate (9.3kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody.|Lane 1: TIMM8B transfected lysate (9.3kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TIMM8B is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TIMM8B is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TIMM8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
9,344 Da
NCBI Official Full Name
TIMM8b
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 8 homolog B (yeast)
NCBI Official Symbol
TIMM8B
NCBI Official Synonym Symbols
DDP2; TIM8B
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim8 B; DDP-like protein; deafness dystonia protein 2
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim8 B
UniProt Gene Name
TIMM8B
UniProt Synonym Gene Names
DDP2; DDPL; TIM8B
UniProt Entry Name
TIM8B_HUMAN

NCBI Description

This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.[provided by RefSeq, Aug 2009]

Uniprot Description

Function: Probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space

By similarity.

Subunit structure: Heterohexamer; possibly composed of 3 copies of TIMM8B and 3 copies of TIMM13, named soluble 70 kDa complex. Associates with the TIM22 complex, whose core is composed of TIMM22

By similarity.

Subcellular location: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side

By similarity.

Tissue specificity: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. Ref.2

Domain: The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of TIMM8B from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane

By similarity.

Sequence similarities: Belongs to the small Tim family.

Research Articles on TIMM8B

Similar Products

Product Notes

The TIMM8B timm8b (Catalog #AAA648656) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM8B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 0.3ug/ml. Researchers should empirically determine the suitability of the TIMM8B timm8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAELGEADEA ELQRLVAAEQ QKAQFTAQVH HFMELCWDKC VEKPGNRLDS RTENCLSSCV DRFIDTTLAI TSRFAQIVQK GGQ. It is sometimes possible for the material contained within the vial of "TIMM8B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.