Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (44.04kD).)

Mouse anti-Human ARL2BP Monoclonal Antibody | anti-ARL2BP antibody

ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein, ARF-like 2-binding Protein, Binder of ARF2 Protein 1, BART, BART1) (HRP)

Gene Names
ARL2BP; BART; RP66; BART1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARL2BP; Monoclonal Antibody; ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein; ARF-like 2-binding Protein; Binder of ARF2 Protein 1; BART; BART1) (HRP); anti-ARL2BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G6
Specificity
Recognizes human ARL2BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ARL2BP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-164 from ARL2BP (AAH03087) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (44.04kD).)

Western Blot (WB)

(Western Blot analysis of ARL2BP expression in transfected 293T cell line by ARL2BP monoclonal antibody. Lane 1: ARL2BP transfected lysate (Predicted MW: 18.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARL2BP expression in transfected 293T cell line by ARL2BP monoclonal antibody. Lane 1: ARL2BP transfected lysate (Predicted MW: 18.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ARL2BP is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARL2BP is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-ARL2BP antibody
ARL2BP is an effector of ADP-ribosylation factor-like 2(ARL2) that is essential for nuclear retention of STAT3. This protein binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. Though predominantly cytosolic, ARL2BP can enter the mitochondria and bind the adenine nucleotide transporter when bound to ARL2. Thus it may also be involved in mitochondria transport and apoptosis.
Product Categories/Family for anti-ARL2BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,711 Da
NCBI Official Full Name
Homo sapiens ADP-ribosylation factor-like 2 binding protein, mRNA
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 2 binding protein
NCBI Official Symbol
ARL2BP
NCBI Official Synonym Symbols
BART; RP66; BART1
NCBI Protein Information
ADP-ribosylation factor-like protein 2-binding protein

NCBI Description

ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008]

Research Articles on ARL2BP

Similar Products

Product Notes

The ARL2BP (Catalog #AAA6151270) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein, ARF-like 2-binding Protein, Binder of ARF2 Protein 1, BART, BART1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL2BP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARL2BP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARL2BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.