Mouse anti-Human ARL2BP Monoclonal Antibody | anti-ARL2BP antibody

ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein, ARF-like 2-binding Protein, Binder of ARF2 Protein 1, BART, BART1) (FITC)

Cat. Num. AAA6145967

• Gene Names: ARL2BP; BART; RP66; BART1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARL2BP; Monoclonal Antibody; ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein; ARF-like 2-binding Protein; Binder of ARF2 Protein 1; BART; BART1) (FITC); anti-ARL2BP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G6
• Specificity: Recognizes human ARL2BP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ARL2BP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-164 from ARL2BP (AAH03087) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44.04kD).)

Western Blot (WB)

(Western Blot analysis of ARL2BP expression in transfected 293T cell line by ARL2BP monoclonal antibody. Lane 1: ARL2BP transfected lysate (Predicted MW: 18.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ARL2BP is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-ARL2BP antibody

ARL2BP is an effector of ADP-ribosylation factor-like 2(ARL2) that is essential for nuclear retention of STAT3. This protein binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. Though predominantly cytosolic, ARL2BP can enter the mitochondria and bind the adenine nucleotide transporter when bound to ARL2. Thus it may also be involved in mitochondria transport and apoptosis.

Product Categories/Family for anti-ARL2BP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13111840
• NCBI GeneID: 23568
• Molecular Weight: 17,711 Da
• NCBI Official Full Name: Homo sapiens ADP-ribosylation factor-like 2 binding protein, mRNA
• NCBI Official Synonym Full Names: ADP ribosylation factor like GTPase 2 binding protein
• NCBI Official Symbol: ARL2BP
• NCBI Official Synonym Symbols: BART; RP66; BART1
• NCBI Protein Information: ADP-ribosylation factor-like protein 2-binding protein
• Protein Family: ADP-ribosylation factor-like protein 2-binding protein

NCBI Description

ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008]