Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARID4A on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human ARID4A Monoclonal Antibody | anti-ARID4A antibody

ARID4A (AT-rich Interactive Domain-containing Protein 4A, ARID Domain-containing Protein 4A, Retinoblastoma-binding Protein 1, RBBP-1, RBBP1, RBP1) (AP)

Gene Names
ARID4A; RBP1; RBBP1; RBP-1; RBBP-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARID4A; Monoclonal Antibody; ARID4A (AT-rich Interactive Domain-containing Protein 4A; ARID Domain-containing Protein 4A; Retinoblastoma-binding Protein 1; RBBP-1; RBBP1; RBP1) (AP); anti-ARID4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G8
Specificity
Recognizes human ARID4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ARID4A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1033-1140, from ARID4A (NP_002883) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARID4A on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARID4A on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ARID4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
143kDa
NCBI Official Full Name
AT-rich interactive domain-containing protein 4A isoform I
NCBI Official Synonym Full Names
AT-rich interaction domain 4A
NCBI Official Symbol
ARID4A
NCBI Official Synonym Symbols
RBP1; RBBP1; RBP-1; RBBP-1
NCBI Protein Information
AT-rich interactive domain-containing protein 4A
UniProt Protein Name
AT-rich interactive domain-containing protein 4A
UniProt Gene Name
ARID4A
UniProt Synonym Gene Names
RBBP1; RBP1; ARID domain-containing protein 4A; RBBP-1
UniProt Entry Name
ARI4A_HUMAN

NCBI Description

The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq, Jul 2008]

Research Articles on ARID4A

Similar Products

Product Notes

The ARID4A arid4a (Catalog #AAA6130057) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARID4A (AT-rich Interactive Domain-containing Protein 4A, ARID Domain-containing Protein 4A, Retinoblastoma-binding Protein 1, RBBP-1, RBBP1, RBP1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARID4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARID4A arid4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARID4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.