Mouse anti-Human ARID3A Monoclonal Antibody | anti-ARID3A antibody

ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B-cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1)

Cat. Num. AAA646424

• Gene Names: ARID3A; DRIL1; DRIL3; BRIGHT; E2FBP1
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ARID3A; Monoclonal Antibody; ARID3A (AT-rich Interactive Domain-containing Protein 3A; ARID Domain-containing Protein 3A; B-cell Regulator of IgH Transcription; Bright; Dead Ringer-like Protein 1; E2F-binding Protein 1; DRIL1; DRIL3; DRX; E2FBP1); Anti -ARID3A (AT-rich Interactive Domain-containing Protein 3A; anti-ARID3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A11
• Specificity: Recognizes human ARID3A.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS

• Applicable Applications for anti-ARID3A antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa317-416 from human ARID3A (NP_005215) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(ARID3A monoclonal antibody, Western Blot analysis of ARID3A expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ARID3A is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-ARID3A antibody

Transcription factor which may be involved in the control of cell cycle progression by the RB1/E2F1 pathway and in B-cell differentiation.

Product Categories/Family for anti-ARID3A antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4885193
• NCBI GeneID: 1820
• NCBI Accession #: NP_005215.1
• NCBI GenBank Nucleotide #: NM_005224.2
• UniProt Accession #: Q99856; Q5I858; Q6P9C6; Q8IZA7; Q8N4Z3
• Molecular Weight: 62,889 Da
• NCBI Official Full Name: AT-rich interactive domain-containing protein 3A
• NCBI Official Synonym Full Names: AT rich interactive domain 3A (BRIGHT-like)
• NCBI Official Symbol: ARID3A
• NCBI Official Synonym Symbols: DRIL1; DRIL3; BRIGHT; E2FBP1
• NCBI Protein Information: AT-rich interactive domain-containing protein 3A; dead ringer-like 1; E2F-binding protein 1; ARID domain-containing 3A; dead ringer-like protein 1; ARID domain-containing protein 3A; B-cell regulator of IgH transcription; AT rich interactive domain 3A (BRIGHT- like) protein
• UniProt Protein Name: AT-rich interactive domain-containing protein 3A
• Protein Family: AT-rich interactive domain-containing protein
• UniProt Gene Name: ARID3A
• UniProt Synonym Gene Names: DRIL1; DRIL3; DRX; E2FBP1; ARID domain-containing protein 3A; Bright
• UniProt Entry Name: ARI3A_HUMAN

NCBI Description

This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Transcription factor which may be involved in the control of cell cycle progression by the RB1/E2F1 pathway and in B-cell differentiation. Ref.6 Ref.7

Subunit structure: Homodimer. Heterodimer with ARID3B. Interacts with E2F1. Interacts with GTF2I and BTK. Ref.2 Ref.9 Ref.10

Subcellular location: Nucleus. Cytoplasm. Note: Shuttles between nucleus and cytoplasm. Ref.10

Tissue specificity: Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.

Induction: By p53/TP53 following DNA damage. Ref.7

Sequence similarities: Contains 1 ARID domain.Contains 1 REKLES domain.

Sequence caution: The sequence AAW30734.1 differs from that shown. Reason: Frameshift at position 498.