Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.)

Mouse ARHGEF9 Monoclonal Antibody | anti-ARHGEF9 antibody

ARHGEF9 (Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9, COLLYBISTIN, HPEM-2, KIAA0424, PEM-2, PEM2) (PE)

Gene Names
ARHGEF9; PEM2; EIEE8; PEM-2; HPEM-2; COLLYBISTIN
Applications
Western Blot
Purity
Purified
Synonyms
ARHGEF9; Monoclonal Antibody; ARHGEF9 (Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9; COLLYBISTIN; HPEM-2; KIAA0424; PEM-2; PEM2) (PE); Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9; PEM2; anti-ARHGEF9 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C11
Specificity
Recognizes ARHGEF9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ARHGEF9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ARHGEF9 (NP_056000.1, 419aa-516aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.)

Western Blot (WB) (ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged ARHGEF9 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARHGEF9 is 3 ng/ml as a capture antibody.)
Related Product Information for anti-ARHGEF9 antibody
ARHGEF9 belongs to a family of Rho-like GTPases that act as molecular switches by cycling from the active GTP-bound state to the inactive GDP-bound state. These proteins are key regulators of the actin cytoskeleton and are involved in cell signaling. [supplied by OMIM]
Product Categories/Family for anti-ARHGEF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,458 Da
NCBI Official Full Name
rho guanine nucleotide exchange factor 9 isoform 1
NCBI Official Synonym Full Names
Cdc42 guanine nucleotide exchange factor (GEF) 9
NCBI Official Symbol
ARHGEF9
NCBI Official Synonym Symbols
PEM2; EIEE8; PEM-2; HPEM-2; COLLYBISTIN
NCBI Protein Information
rho guanine nucleotide exchange factor 9; PEM-2 homolog; hPEM-2 collybistin; rac/Cdc42 guanine nucleotide exchange factor 9
UniProt Protein Name
Rho guanine nucleotide exchange factor 9
UniProt Gene Name
ARHGEF9
UniProt Synonym Gene Names
ARHDH9; KIAA0424
UniProt Entry Name
ARHG9_HUMAN

NCBI Description

The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. Defects in this gene are a cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010]

Uniprot Description

ARHGEF9: Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters. Defects in ARHGEF9 are the cause of pileptic encephalopathy, early infantile, type 8 (EIEE8). A disorder characterized by hyperekplexia and early infantile epileptic encephalopathy. Neurologic features include exaggerated startle response, seizures, impaired psychomotor development, and mental retardation. Seizures can be provoked by tactile stimulation or extreme emotion. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: Xq11.1

Cellular Component: cytoplasm; cytosol

Molecular Function: Rho guanyl-nucleotide exchange factor activity

Biological Process: synaptic transmission; regulation of small GTPase mediated signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; small GTPase mediated signal transduction; transmembrane transport

Disease: Epileptic Encephalopathy, Early Infantile, 8

Research Articles on ARHGEF9

Similar Products

Product Notes

The ARHGEF9 arhgef9 (Catalog #AAA6187539) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ARHGEF9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGEF9 arhgef9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGEF9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.