Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ARHGEF10 monoclonal antibody (M02), clone 6G5. Western Blot analysis of ARHGEF10 expression in HepG2.)

Mouse ARHGEF10 Monoclonal Antibody | anti-ARHGEF10 antibody

ARHGEF10 (Rho Guanine Nucleotide Exchange Factor (GEF) 10, DKFZp686H0726, GEF10, MGC131664) (PE)

Gene Names
ARHGEF10; SNCV; GEF10
Applications
Western Blot
Purity
Purified
Synonyms
ARHGEF10; Monoclonal Antibody; ARHGEF10 (Rho Guanine Nucleotide Exchange Factor (GEF) 10; DKFZp686H0726; GEF10; MGC131664) (PE); Rho Guanine Nucleotide Exchange Factor (GEF) 10; MGC131664; anti-ARHGEF10 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G5
Specificity
Recognizes ARHGEF10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ARHGEF10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ARHGEF10 (NP_055444, 792aa-890aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ARHGEF10 monoclonal antibody (M02), clone 6G5. Western Blot analysis of ARHGEF10 expression in HepG2.)

Western Blot (WB) (ARHGEF10 monoclonal antibody (M02), clone 6G5. Western Blot analysis of ARHGEF10 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged ARHGEF10 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARHGEF10 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-ARHGEF10 antibody
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. [provided by RefSeq]
Product Categories/Family for anti-ARHGEF10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
149kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 10 isoform 1
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 10
NCBI Official Symbol
ARHGEF10
NCBI Official Synonym Symbols
SNCV; GEF10
NCBI Protein Information
rho guanine nucleotide exchange factor 10
UniProt Protein Name
Rho guanine nucleotide exchange factor 10
UniProt Gene Name
ARHGEF10
UniProt Synonym Gene Names
KIAA0294
UniProt Entry Name
ARHGA_HUMAN

NCBI Description

This gene encodes a Rho guanine nucleotide exchange factor (GEF). Rho GEFs regulate the activity of small Rho GTPases by stimulating the exchange of guanine diphosphate (GDP) for guanine triphosphate (GTP) and may play a role in neural morphogenesis. Mutations in this gene are associated with slowed nerve conduction velocity (SNCV). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

ARHGEF10: May play a role in developmental myelination of peripheral nerves. Defects in ARHGEF10 are the cause of slowed nerve conduction velocity (SNCV). Affected individuals present a reduction in nerve conduction velocities without any clinical signs of peripheral or central nervous system dysfunction. SNCV inheritance is autosomal dominant. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rac/Rho

Chromosomal Location of Human Ortholog: 8p23

Cellular Component: centrosome; cytosol

Molecular Function: protein binding; Rho guanyl-nucleotide exchange factor activity; kinesin binding

Biological Process: positive regulation of stress fiber formation; centrosome duplication; myelination in the peripheral nervous system

Disease: Slowed Nerve Conduction Velocity, Autosomal Dominant

Research Articles on ARHGEF10

Similar Products

Product Notes

The ARHGEF10 arhgef10 (Catalog #AAA6187387) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ARHGEF10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGEF10 arhgef10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGEF10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.