Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARHGEF10 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellARHGEF10 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit anti-Human ARHGEF10 Polyclonal Antibody | anti-ARHGEF10 antibody

ARHGEF10 Antibody - C-terminal region

Gene Names
ARHGEF10; SNCV; GEF10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGEF10; Polyclonal Antibody; ARHGEF10 Antibody - C-terminal region; anti-ARHGEF10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRDSLAPGPEPQDEDQKDALPSGGAGSSLSQGDPDAAIWLGDSLGSMTQK
Sequence Length
1344
Applicable Applications for anti-ARHGEF10 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARHGEF10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARHGEF10 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellARHGEF10 is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-ARHGEF10 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellARHGEF10 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-ARHGEF10 antibody
This is a rabbit polyclonal antibody against ARHGEF10. It was validated on Western Blot

Target Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals.
Product Categories/Family for anti-ARHGEF10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
149kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 10 isoform 1
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 10
NCBI Official Symbol
ARHGEF10
NCBI Official Synonym Symbols
SNCV; GEF10
NCBI Protein Information
rho guanine nucleotide exchange factor 10
UniProt Protein Name
Rho guanine nucleotide exchange factor 10
UniProt Gene Name
ARHGEF10
UniProt Synonym Gene Names
KIAA0294
UniProt Entry Name
ARHGA_HUMAN

NCBI Description

This gene encodes a Rho guanine nucleotide exchange factor (GEF). Rho GEFs regulate the activity of small Rho GTPases by stimulating the exchange of guanine diphosphate (GDP) for guanine triphosphate (GTP) and may play a role in neural morphogenesis. Mutations in this gene are associated with slowed nerve conduction velocity (SNCV). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

ARHGEF10: May play a role in developmental myelination of peripheral nerves. Defects in ARHGEF10 are the cause of slowed nerve conduction velocity (SNCV). Affected individuals present a reduction in nerve conduction velocities without any clinical signs of peripheral or central nervous system dysfunction. SNCV inheritance is autosomal dominant. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rac/Rho

Chromosomal Location of Human Ortholog: 8p23

Cellular Component: centrosome; cytosol

Molecular Function: protein binding; Rho guanyl-nucleotide exchange factor activity; kinesin binding

Biological Process: positive regulation of stress fiber formation; centrosome duplication; myelination in the peripheral nervous system

Disease: Slowed Nerve Conduction Velocity, Autosomal Dominant

Research Articles on ARHGEF10

Similar Products

Product Notes

The ARHGEF10 arhgef10 (Catalog #AAA3216813) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF10 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGEF10 arhgef10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRDSLAPGPE PQDEDQKDAL PSGGAGSSLS QGDPDAAIWL GDSLGSMTQK. It is sometimes possible for the material contained within the vial of "ARHGEF10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.