Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (50.49kD).)

Mouse anti-Human ARHGDIG Monoclonal Antibody | anti-ARHGDIG antibody

ARHGDIG (RHOGDI-3, RhoGDI gamma, Rho GDP dissociation inhibitor [GDI] gamma) (AP)

Gene Names
ARHGDIG; RHOGDI-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARHGDIG; Monoclonal Antibody; ARHGDIG (RHOGDI-3; RhoGDI gamma; Rho GDP dissociation inhibitor [GDI] gamma) (AP); anti-ARHGDIG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D11
Specificity
Recognizes human ARHGDIG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ARHGDIG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-225 from human ARHGDIG (AAH47699) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.49kD).)

Western Blot (WB) (Western Blot detection against Immunogen (50.49kD).)
Related Product Information for anti-ARHGDIG antibody
Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP.
Product Categories/Family for anti-ARHGDIG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
398
Molecular Weight
25,098 Da
NCBI Official Full Name
Homo sapiens Rho GDP dissociation inhibitor (GDI) gamma, mRNA
NCBI Official Synonym Full Names
Rho GDP dissociation inhibitor (GDI) gamma
NCBI Official Symbol
ARHGDIG
NCBI Official Synonym Symbols
RHOGDI-3
NCBI Protein Information
rho GDP-dissociation inhibitor 3; RhoGDI gamma; rho GDI 3; rho-GDI gamma

NCBI Description

The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).[supplied by OMIM, Nov 2010]

Research Articles on ARHGDIG

Similar Products

Product Notes

The ARHGDIG (Catalog #AAA6130050) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARHGDIG (RHOGDI-3, RhoGDI gamma, Rho GDP dissociation inhibitor [GDI] gamma) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGDIG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGDIG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGDIG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.