Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human APTX Monoclonal Antibody | anti-APTX antibody

APTX (Forkhead-associated Domain Histidine Triad-like Protein, FHA-HIT, Aprataxin, AXA1, FLJ20157, MGC1072) (AP)

Gene Names
APTX; AOA; AOA1; AXA1; EAOH; EOAHA; FHA-HIT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APTX; Monoclonal Antibody; APTX (Forkhead-associated Domain Histidine Triad-like Protein; FHA-HIT; Aprataxin; AXA1; FLJ20157; MGC1072) (AP); anti-APTX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
2H6
Specificity
Recognizes human APTX.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-APTX antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa69-167 from human APTX (NP_778241) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHW
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of APTX expression in transfected 293T cell line by APTX monoclonal antibody. Lane 1: APTX transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of APTX expression in transfected 293T cell line by APTX monoclonal antibody. Lane 1: APTX transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged APTX is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged APTX is 3ng/ml as a capture antibody.)
Related Product Information for anti-APTX antibody
APTX is encoding a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair.
Product Categories/Family for anti-APTX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23.9kDa (205aa), confirmed by MALDI-TOF.
NCBI Official Synonym Full Names
aprataxin
NCBI Official Symbol
APTX
NCBI Official Synonym Symbols
AOA; AOA1; AXA1; EAOH; EOAHA; FHA-HIT
NCBI Protein Information
aprataxin
Protein Family

NCBI Description

This gene encodes a member of the histidine triad (HIT) superfamily. The encoded protein may play a role in single-stranded DNA repair through its nucleotide-binding activity and its diadenosine polyphosphate hydrolase activity. Mutations in this gene have been associated with ataxia-ocular apraxia. Alternatively spliced transcript variants have been identified for this gene.[provided by RefSeq, Aug 2010]

Research Articles on APTX

Similar Products

Product Notes

The APTX (Catalog #AAA6130038) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APTX (Forkhead-associated Domain Histidine Triad-like Protein, FHA-HIT, Aprataxin, AXA1, FLJ20157, MGC1072) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APTX can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APTX for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APTX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.