Mouse anti-Human ANXA5 Monoclonal Antibody | anti-ANXA5 antibody

ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII,

Cat. Num. AAA6140614

• Gene Names: ANXA5; PP4; ANX5; ENX2; RPRGL3; HEL-S-7
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANXA5; Monoclonal Antibody; ANXA5 (Annexin A5; Annexin-5; Annexin V; Lipocortin V; Endonexin II; Calphobindin I; CBP-I; Placental Anticoagulant Protein I; PAP-I; Placental Anticoagulant Protein 4; PP4; Thromboplastin Inhibitor; Vascular Anticoagulant-alpha; VAC-alpha; Anchorin CII; ; anti-ANXA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F4-1A5
• Specificity: Recognizes human ANXA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ANXA5 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-320 from human ANXA5 (AAH01429) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ANXA5 monoclonal antibody, Western Blot analysis of ANXA5 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody. Lane 1: ANXA5 transfected lysate (35.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ANXA5 is ~0.03ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of ANXA5 transfected lysate using ANXA5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ANXA5 rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (60.94kD).)

Product Categories/Family for anti-ANXA5 antibody

Antibodies; Apoptosis

References

1. Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: A pilot Proteomics-based study. Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F.Biochem Biophys Res Commun. 2012 Apr 6;420(2):357-63. Epub 2012 Mar 8. 2. Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells. Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.J Proteomics. 2011 Nov 7. 3. The Differential Expression of Aqueous Soluble Proteins in Breast Normal and Cancerous Tissues in Relation to Stage and Grade of Patients. Liang S, Singh M, Gam LH.Journal of Biomedicine and Biotechnology doi:10.1155/ 2010/516469

NCBI and Uniprot Product Information

• NCBI GI #: 33876205
• NCBI GeneID: 308
• Molecular Weight: 35,937 Da
• NCBI Official Full Name: Homo sapiens annexin A5, mRNA
• NCBI Official Synonym Full Names: annexin A5
• NCBI Official Symbol: ANXA5
• NCBI Official Synonym Symbols: PP4; ANX5; ENX2; RPRGL3; HEL-S-7
• NCBI Protein Information: annexin A5
• Protein Family: Annexin

NCBI Description

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]