Mouse anti-Human ANGPTL6 Monoclonal Antibody | anti-ANGPTL6 antibody

ANGPTL6 (Angiopoietin-related Protein 6, Angiopoietin-like Protein 6, Angiopoietin-related Growth Factor, Angiopoietin-related Protein 5, UNQ152/PRO178, AGF, ARP5) (HRP)

Cat. Num. AAA6151206

• Gene Names: ANGPTL6; AGF; ARP5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANGPTL6; Monoclonal Antibody; ANGPTL6 (Angiopoietin-related Protein 6; Angiopoietin-like Protein 6; Angiopoietin-related Growth Factor; Angiopoietin-related Protein 5; UNQ152/PRO178; AGF; ARP5) (HRP); anti-ANGPTL6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H8
• Specificity: Recognizes human ANGPTL6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ANGPTL6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa211-300 from human ANGPTL6 (NP_114123) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Testing Data

(Detection limit for recombinant GST tagged ANGPTL6 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-ANGPTL6 antibody

Angiopoietin-like 6 (ANGPTL6), also known as angiopoietin related growth factor (AGF), is a secreted 50kD protein that contains a coiled coil domain aa51-77, 126-164 and a fibrinogen-like domain aa238-456. A conserved Integrin binding RGD motif is located within the fibrinogen-like domain. This enables ANGPTL6 to promote skin wound healing by mediating the adhesion and migration of keratinocytes, fibroblasts, and endothelial cells. ANGPTL6 also promotes the chemotaxis of vascular endothelial cells resulting in increased vascular permeability and angiogenesis. ANGPTL6 is also secreted by hepatocytes. It inhibits gluconeogenesis in these cells and promotes insulin sensitivity and energy expenditure in mice fed high fat diets. Serum levels of ANGPTL6 are elevated in metabolic syndrome, diabetes, and preeclampsia but are decreased in chronic renal failure. ANGPTL6 is additionally produced by several hematopoietic cell types including megakaryocytes, platelets, mast cells, and uterine NK cells. Mature mouse ANGPTL6 shares 75% and 95% sequence identity with human and rat ANGPTL6.

Product Categories/Family for anti-ANGPTL6 antibody

Antibodies; Angiopoietin

NCBI and Uniprot Product Information

• NCBI GI #: 29893555
• NCBI GeneID: 83854
• NCBI Accession #: NP_114123
• NCBI GenBank Nucleotide #: NM_031917
• UniProt Accession #: Q8NI99; Q9BZZ0; A5PKV7
• Molecular Weight: 51,694 Da
• NCBI Official Full Name: angiopoietin-related protein 6
• NCBI Official Synonym Full Names: angiopoietin-like 6
• NCBI Official Symbol: ANGPTL6
• NCBI Official Synonym Symbols: AGF; ARP5
• NCBI Protein Information: angiopoietin-related protein 6; angiopoietin-like protein 6; angiopoietin-related growth factor; angiopoietin-related protein 5
• UniProt Protein Name: Angiopoietin-related protein 6
• Protein Family: Angiopoietin-related protein
• UniProt Gene Name: ANGPTL6
• UniProt Synonym Gene Names: AGF; ARP5

Uniprot Description

May play a role in the wound healing process. May promote epidermal proliferation, remodeling and regeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteract high-fat diet-induced obesity and related insulin resistance through increased energy expenditure.