Testing Data
(EZH2 monoclonal antibody (M01), clone 2C3 recognizes the appropriate size (95 KDa) full length protein in human prostrate cancer cells (DU145, whole cell extract made in modified RIPA buffer), Primary Ab dilution = 1 : 1000. Mouse-HRPO dilution = 1 : 25000.)
Mouse EZH2 Monoclonal Antibody | anti-EZH2 antibody
EZH2 (Enhancer of zeste Homolog 2 (Drosophila), ENX-1, EZH1, KMT6, MGC9169) (FITC)
Gene Names
EZH2; WVS; ENX1; EZH1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EZH2; Monoclonal Antibody; EZH2 (Enhancer of zeste Homolog 2 (Drosophila); ENX-1; EZH1; KMT6; MGC9169) (FITC); Enhancer of zeste Homolog 2 (Drosophila); MGC9169; anti-EZH2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C3
Specificity
Recognizes EZH2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-EZH2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EZH2 (AAH10858, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(EZH2 monoclonal antibody (M01), clone 2C3 recognizes the appropriate size (95 KDa) full length protein in human prostrate cancer cells (DU145, whole cell extract made in modified RIPA buffer), Primary Ab dilution = 1 : 1000. Mouse-HRPO dilution = 1 : 25000.)
Testing Data
(EZH2 monoclonal antibody (M01), clone 2C3 recognizes the appropriate size (95 KDa) full length protein in human prostrate cancer cells (DU145, whole cell extract made in modified RIPA buffer), Primary Ab dilution = 1 : 1000. Mouse-HRPO dilution = 1 : 25000.)
Related Product Information for anti-EZH2 antibody
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-EZH2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
79,621 Da
NCBI Official Full Name
histone-lysine N-methyltransferase EZH2 isoform a
NCBI Official Synonym Full Names
enhancer of zeste 2 polycomb repressive complex 2 subunit
NCBI Official Symbol
EZH2
NCBI Official Synonym Symbols
WVS; ENX1; EZH1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
NCBI Protein Information
histone-lysine N-methyltransferase EZH2; enhancer of zeste homolog 2; lysine N-methyltransferase 6
UniProt Protein Name
Histone-lysine N-methyltransferase EZH2
Protein Family
UniProt Gene Name
EZH2
UniProt Synonym Gene Names
KMT6
UniProt Entry Name
EZH2_HUMAN
NCBI Description
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
Research Articles on EZH2
Similar Products
Product Notes
The EZH2 ezh2 (Catalog #AAA6178516) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EZH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EZH2 ezh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EZH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
