Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human ANAPC2 Monoclonal Antibody | anti-ANAPC2 antibody

ANAPC2 (Anaphase-promoting Complex Subunit 2, Cyclosome Subunit 2, APC2, KIAA1406, RP11-350O14.5) (PE)

Gene Names
ANAPC2; APC2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANAPC2; Monoclonal Antibody; ANAPC2 (Anaphase-promoting Complex Subunit 2; Cyclosome Subunit 2; APC2; KIAA1406; RP11-350O14.5) (PE); anti-ANAPC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8G2
Specificity
Recognizes human ANAPC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ANAPC2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa716-823 from human ANAPC2 (NP_037498) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)
Related Product Information for anti-ANAPC2 antibody
APC2 (molecular weight 92kD) is a cullin-related subunit of the anaphase-promoting complex (APC), or cyclosome. APC2 specifically interacts with APC11, another APC subunit.
Product Categories/Family for anti-ANAPC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,469 Da
NCBI Official Full Name
anaphase-promoting complex subunit 2
NCBI Official Synonym Full Names
anaphase promoting complex subunit 2
NCBI Official Symbol
ANAPC2
NCBI Official Synonym Symbols
APC2
NCBI Protein Information
anaphase-promoting complex subunit 2
UniProt Protein Name
Anaphase-promoting complex subunit 2
UniProt Gene Name
ANAPC2
UniProt Synonym Gene Names
APC2; KIAA1406
UniProt Entry Name
ANC2_HUMAN

NCBI Description

A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation. [provided by RefSeq, Jul 2008]

Research Articles on ANAPC2

Similar Products

Product Notes

The ANAPC2 anapc2 (Catalog #AAA6156502) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANAPC2 (Anaphase-promoting Complex Subunit 2, Cyclosome Subunit 2, APC2, KIAA1406, RP11-350O14.5) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANAPC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANAPC2 anapc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANAPC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.