Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.05kD).)

Mouse anti-Human ANAPC11 Monoclonal Antibody | anti-ANAPC11 antibody

ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP)

Gene Names
ANAPC11; APC11; Apc11p; HSPC214
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANAPC11; Monoclonal Antibody; ANAPC11 (Anaphase-promoting Complex Subunit 11; APC11; Cyclosome Subunit 11; Hepatocellular Carcinoma-associated RING Finger Protein; HSPC214; MGC882) (HRP); anti-ANAPC11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B4-1A4
Specificity
Recognizes human ANAPC11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
901
Applicable Applications for anti-ANAPC11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-55 from human ANAPC11 (AAH00607) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.05kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.05kD).)

Testing Data

(Detection limit for recombinant GST tagged ANAPC11 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ANAPC11 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with CDC20 rabbit purified polyclonal 1:1200 and ANAPC11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with CDC20 rabbit purified polyclonal 1:1200 and ANAPC11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ANAPC11 antibody
Anaphase-promoting complex (APC) is homologous to the two highly conserved RING finger proteins ROC1 and ROC2. APC11 specifically interacts with APC2, a cullin-related APC subunit. ROC1 and APC11 immunocomplexes can catalyze isopeptide ligations to form polyubiquitin chains in an E1-and E2-dependent manner. Combinations of ROC/APC11 and cullin proteins potentially constitute a wide variety of ubiquitin ligases.
Product Categories/Family for anti-ANAPC11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens anaphase promoting complex subunit 11, mRNA
NCBI Official Synonym Full Names
anaphase promoting complex subunit 11
NCBI Official Symbol
ANAPC11
NCBI Official Synonym Symbols
APC11; Apc11p; HSPC214
NCBI Protein Information
anaphase-promoting complex subunit 11

Research Articles on ANAPC11

Similar Products

Product Notes

The ANAPC11 (Catalog #AAA6151198) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANAPC11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANAPC11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANAPC11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.