Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRDM5Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PRDM5 Polyclonal Antibody | anti-PRDM5 antibody

PRDM5 Antibody - N-terminal region

Gene Names
PRDM5; BCS2; PFM2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRDM5; Polyclonal Antibody; PRDM5 Antibody - N-terminal region; anti-PRDM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI
Sequence Length
111
Applicable Applications for anti-PRDM5 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRDM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRDM5Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRDM5Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRDM5 antibody
This is a rabbit polyclonal antibody against PRDM5. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis.
Product Categories/Family for anti-PRDM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
PR domain zinc finger protein 5 isoform 1
NCBI Official Synonym Full Names
PR/SET domain 5
NCBI Official Symbol
PRDM5
NCBI Official Synonym Symbols
BCS2; PFM2
NCBI Protein Information
PR domain zinc finger protein 5
UniProt Protein Name
PR domain zinc finger protein 5
UniProt Gene Name
PRDM5
UniProt Synonym Gene Names
PFM2
UniProt Entry Name
PRDM5_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

PRDM5: Sequence-specific DNA-binding transcription factor. Represses transcription at least in part by recruitment of the histone methyltransferase EHMT2/G9A and histone deacetylases such as HDAC1. Regulates hematopoiesis-associated protein-coding and microRNA (miRNA) genes. May regulate the expression of proteins involved in extracellular matrix development and maintenance, including fibrillar collagens, such as COL4A1 and COL11A1, connective tissue components, such as HAPLN1, and molecules regulating cell migration and adhesion, including EDIL3 and TGFB2. May caused G2/M arrest and apoptosis in cancer cells. Defects in PRDM5 are the cause of Brittle cornea syndrome type 2 (BCS2). A disorder characterized by extreme corneal thinning resulting in corneal rupture after minor trauma, blue sclerae, keratoconus or keratoglobus, hyperelasticity of the skin, and hypermobile joints. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Methyltransferase, protein lysine, predicted; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 4q25-q26

Cellular Component: nucleus

Molecular Function: methyltransferase activity; protein binding; sequence-specific DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; histone deacetylation; mitotic cell cycle; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; histone H3-K9 methylation

Disease: Brittle Cornea Syndrome 2

Research Articles on PRDM5

Similar Products

Product Notes

The PRDM5 prdm5 (Catalog #AAA3204584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDM5 Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRDM5 prdm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGLYTARRVR KGEKFGPFAG EKRMPEDLDE NMDYRLMWEV RGSKGEVLYI. It is sometimes possible for the material contained within the vial of "PRDM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.