Mouse anti-Human ANAPC11 Monoclonal Antibody | anti-ANAPC11 antibody

ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882)

Cat. Num. AAA6007722

• Gene Names: ANAPC11; APC11; Apc11p; HSPC214
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ANAPC11; Monoclonal Antibody; ANAPC11 (Anaphase-promoting Complex Subunit 11; APC11; Cyclosome Subunit 11; Hepatocellular Carcinoma-associated RING Finger Protein; HSPC214; MGC882); Anti -ANAPC11 (Anaphase-promoting Complex Subunit 11; anti-ANAPC11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B4-1A4
• Specificity: Recognizes human ANAPC11.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

• Applicable Applications for anti-ANAPC11 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-55 from human ANAPC11 (AAH00607) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.05kD).)

Testing Data

(Detection limit for recombinant GST tagged ANAPC11 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with CDC20 rabbit purified polyclonal 1:1200 and ANAPC11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-ANAPC11 antibody

Anaphase-promoting complex (APC) is homologous to the two highly conserved RING finger proteins ROC1 and ROC2. APC11 specifically interacts with APC2, a cullin-related APC subunit. ROC1 and APC11 immunocomplexes can catalyze isopeptide ligations to form polyubiquitin chains in an E1-and E2-dependent manner. Combinations of ROC/APC11 and cullin proteins potentially constitute a wide variety of ubiquitin ligases.

Product Categories/Family for anti-ANAPC11 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18777675
• NCBI GeneID: 51529
• NCBI Accession #: NP_057560.8
• NCBI GenBank Nucleotide #: NM_016476.10
• UniProt Accession #: Q9NYG5; Q502X9; Q9BW64; Q9P0R2; A8MTT2; B7ZW64
• Molecular Weight: 9,841 Da
• NCBI Official Full Name: anaphase-promoting complex subunit 11 isoform 2
• NCBI Official Synonym Full Names: anaphase promoting complex subunit 11
• NCBI Official Symbol: ANAPC11
• NCBI Official Synonym Symbols: APC11; Apc11p; HSPC214
• NCBI Protein Information: anaphase-promoting complex subunit 11; cyclosome subunit 11; APC11 anaphase promoting complex subunit 11 homolog; hepatocellular carcinoma-associated RING finger protein; anaphase promoting complex subunit 11 (yeast APC11 homolog)
• UniProt Protein Name: Anaphase-promoting complex subunit 11
• UniProt Gene Name: ANAPC11
• UniProt Synonym Gene Names: APC11
• UniProt Entry Name: APC11_HUMAN

Uniprot Description

APC11: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex. Belongs to the RING-box family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase; Cell cycle regulation; Ubiquitin ligase; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: nucleoplasm; anaphase-promoting complex; nucleolus; cytosol

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; mitosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle spindle assembly checkpoint; protein ubiquitination; mitotic cell cycle