Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human Amphiregulin Monoclonal Antibody | anti-AREG antibody

Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin precursor, AR, Colorectum cell-derived growth factor, CRDGF, MGC13647, SDGF, AREG) APC

Gene Names
AREG; AR; SDGF; AREGB; CRDGF
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Amphiregulin; Monoclonal Antibody; Amphiregulin (Schwannoma-derived Growth Factor; Amphiregulin precursor; AR; Colorectum cell-derived growth factor; CRDGF; MGC13647; SDGF; AREG) APC; anti-AREG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E4
Specificity
Recognizes human AREG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-AREG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa20-129 from human AREG (AAH09799) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(AREG monoclonal antibody. Western Blot analysis of AREG expression in human pancreas.)

Western Blot (WB) (AREG monoclonal antibody. Western Blot analysis of AREG expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged AREG is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AREG is 0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with CCND3 rabbit purified polyclonal 1:1200 and AREG mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with CCND3 rabbit purified polyclonal 1:1200 and AREG mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-AREG antibody
Amphiregulin (AR) which binds to EGF-Receptor (EGFR) with lower affinity than EGF. The mature secreted form AR is an 84aa residue glycosylated polypeptide growth regulator. It is generated by proteolytic processing of a 252aa transmembrane precursor. Seven different polypeptide ligands, which derive from distinct genes. These ligands are capable of binding to the extracellular domain of EGFR. They include EGF, TGFa, AR, HB-EGF, cripto-1, epiregulin and betacellulin. All of these growth factors contain a characteristic EGF-like domain which is defined by 6 evenly spaced cysteine residues that generate 3 loops through the formation of disulfide bonds. AR protein is localized to the epithelium of the colon, stomach, pancreas, breast and placenta. AR is reportedly overexpressed in human cancers of breast, colon, stomach and pancreas.
Product Categories/Family for anti-AREG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
374
Molecular Weight
27,895 Da
NCBI Official Full Name
Homo sapiens amphiregulin, mRNA
NCBI Official Synonym Full Names
amphiregulin
NCBI Official Symbol
AREG
NCBI Official Synonym Symbols
AR; SDGF; AREGB; CRDGF
NCBI Protein Information
amphiregulin
Protein Family

NCBI Description

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). The protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells, and it inhibits the growth of certain aggressive carcinoma cell lines. It also functions in mammary gland, oocyte and bone tissue development. This gene is associated with a psoriasis-like skin phenotype, and is also associated with other pathological disorders, including various types of cancers and inflammatory conditions. [provided by RefSeq, Apr 2014]

Research Articles on AREG

Similar Products

Product Notes

The AREG (Catalog #AAA6135286) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin precursor, AR, Colorectum cell-derived growth factor, CRDGF, MGC13647, SDGF, AREG) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Amphiregulin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AREG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Amphiregulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.