Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AREG expression in transfected 293T cell line by AREG polyclonal antibody. Lane 1: AREG transfected lysate (27.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Amphiregulin Polyclonal Antibody | anti-AREG antibody

Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin precursor, AR, Colorectum cell-derived growth factor, CRDGF, MGC13647, SDGF, AREG) (PE)

Gene Names
AREG; AR; SDGF; CRDGF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Amphiregulin; Polyclonal Antibody; Amphiregulin (Schwannoma-derived Growth Factor; Amphiregulin precursor; AR; Colorectum cell-derived growth factor; CRDGF; MGC13647; SDGF; AREG) (PE); anti-AREG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AREG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AREG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AREG, aa1-252 (NP_001648.1).
Immunogen Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AREG expression in transfected 293T cell line by AREG polyclonal antibody. Lane 1: AREG transfected lysate (27.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AREG expression in transfected 293T cell line by AREG polyclonal antibody. Lane 1: AREG transfected lysate (27.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AREG antibody
Amphiregulin (AR) which binds to EGF-Receptor (EGFR) with lower affinity than EGF. The mature secreted form AR is an 84aa residue glycosylated polypeptide growth regulator. It is generated by proteolytic processing of a 252aa transmembrane precursor. Seven different polypeptide ligands, which derive from distinct genes. These ligands are capable of binding to the extracellular domain of EGFR. They include EGF, TGFa, AR, HB-EGF, cripto-1, epiregulin and betacellulin. All of these growth factors contain a characteristic EGF-like domain which is defined by 6 evenly spaced cysteine residues that generate 3 loops through the formation of disulfide bonds. AR protein is localized to the epithelium of the colon, stomach, pancreas, breast and placenta. AR is reportedly overexpressed in human cancers of breast, colon, stomach and pancreas.
Product Categories/Family for anti-AREG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
374
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,895 Da
NCBI Official Full Name
amphiregulin preproprotein
NCBI Official Synonym Full Names
amphiregulin
NCBI Official Symbol
AREG
NCBI Official Synonym Symbols
AR; SDGF; CRDGF
NCBI Protein Information
amphiregulin; schwannoma-derived growth factor; colorectum cell-derived growth factor
UniProt Protein Name
Amphiregulin
Protein Family
UniProt Gene Name
AREG
UniProt Synonym Gene Names
SDGF; AR; CRDGF
UniProt Entry Name
AREG_HUMAN

NCBI Description

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype. [provided by RefSeq, Jul 2008]

Uniprot Description

AREG: Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts. Belongs to the amphiregulin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; cell surface; cytoplasm; integral to membrane; nucleus

Molecular Function: protein binding; growth factor activity; cytokine activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; response to peptide hormone stimulus; response to cAMP; response to glucocorticoid stimulus; response to estradiol stimulus; glial cell proliferation; G-protein coupled receptor protein signaling pathway; cell proliferation; cell-cell signaling; response to hydrogen peroxide; positive regulation of cell proliferation; negative regulation of osteoblast differentiation; neurite development; positive regulation of DNA replication; positive regulation of phosphorylation

Research Articles on AREG

Similar Products

Product Notes

The AREG areg (Catalog #AAA6369758) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin precursor, AR, Colorectum cell-derived growth factor, CRDGF, MGC13647, SDGF, AREG) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Amphiregulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AREG areg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Amphiregulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.