Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody.)

Mouse AMID Monoclonal Antibody | anti-AMID antibody

AMID (Apoptosis-inducing Factor, mitochondrion-Associated, 2, AMID, PRG3, RP11-367H5.2) (FITC)

Gene Names
AIFM2; AMID; PRG3
Applications
Immunoprecipitation
Purity
Purified
Synonyms
AMID; Monoclonal Antibody; AMID (Apoptosis-inducing Factor; mitochondrion-Associated; 2; PRG3; RP11-367H5.2) (FITC); Apoptosis-inducing Factor; RP11-367H5.2; anti-AMID antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Specificity
Recognizes AMID.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-AMID antibody
Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AMID (NP_116186, 188aa-287aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of AIFM2 transfected lysate using anti-AIFM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AIFM2 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of AIFM2 transfected lysate using anti-AIFM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AIFM2 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-AMID antibody
The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq]
Product Categories/Family for anti-AMID antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
apoptosis-inducing factor 2
NCBI Official Synonym Full Names
apoptosis inducing factor mitochondria associated 2
NCBI Official Symbol
AIFM2
NCBI Official Synonym Symbols
AMID; PRG3
NCBI Protein Information
apoptosis-inducing factor 2
UniProt Protein Name
Apoptosis-inducing factor 2
Protein Family
UniProt Gene Name
AIFM2
UniProt Synonym Gene Names
AMID; PRG3
UniProt Entry Name
AIFM2_HUMAN

NCBI Description

This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]

Uniprot Description

AIFM2: Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest. Belongs to the FAD-dependent oxidoreductase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Mitochondrial; Apoptosis; Membrane protein, integral; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: extracellular space; mitochondrial outer membrane; mitochondrion; cytoplasm; integral to membrane; lipid particle; cytosol

Molecular Function: FAD binding; NADH dehydrogenase (ubiquinone) activity; DNA binding; electron-transferring-flavoprotein dehydrogenase activity

Biological Process: apoptotic mitochondrial changes; positive regulation of apoptosis

Research Articles on AMID

Similar Products

Product Notes

The AMID aifm2 (Catalog #AAA6177530) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AMID can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMID aifm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMID, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.