Mouse anti-Human ALS2CR2 Monoclonal Antibody | anti-ALS2CR2 antibody

ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (PE)

Cat. Num. AAA6156492

• Gene Names: STRADB; PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ALS2CR2; Monoclonal Antibody; ALS2CR2 (STE20-related Kinase Adapter Protein beta; STRAD beta; Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein; CALS-21; ILP-interacting Protein; Pseudokinase ALS2CR2; STRADB; ILPIP; PRO1038) (PE); anti-ALS2CR2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E11
• Specificity: Recognizes human ALS2CR2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ALS2CR2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa319-418 from human ALS2CR2 (AAH08302) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of STRADB expression in transfected 293T cell line by ALS2CR2 monoclonal antibody. Lane 1: STRADB transfected lysate (47kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ALS2CR2 antibody

ALS2CR2, a novel anti-apoptotic protein, belongs to the serine/threonine protein kinase STE20 subfamily. Due to the presence of a protein kinase domain with one of the active site residues altered, ALS2CR2 is known as pseudokinase. ALS2CR2 is a component of a complex involved in the activation of a master kinase serine/threonine kinase 11, that regulates cell polarity and energy-generating metabolism and is known to regulate the relocation of this kinase from the nucleus to the cytoplasm. It is essential for G1 cell cycle arrest mediated by this kinase. ALS2CR2 is known to interact with the X chromosome-linked inhibitor of apoptosis protein, and thus enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway.

Product Categories/Family for anti-ALS2CR2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 14249853
• NCBI GeneID: 55437
• Molecular Weight: 31,219 Da
• NCBI Official Full Name: Homo sapiens STE20-related kinase adaptor beta, mRNA
• NCBI Official Synonym Full Names: STE20-related kinase adaptor beta
• NCBI Official Symbol: STRADB
• NCBI Official Synonym Symbols: PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
• NCBI Protein Information: STE20-related kinase adapter protein beta

NCBI Description

This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]