Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ALS2CR2 Monoclonal Antibody | anti-ALS2CR2 antibody

ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (FITC)

Gene Names
STRADB; PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALS2CR2; Monoclonal Antibody; ALS2CR2 (STE20-related Kinase Adapter Protein beta; STRAD beta; Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein; CALS-21; ILP-interacting Protein; Pseudokinase ALS2CR2; STRADB; ILPIP; PRO1038) (FITC); anti-ALS2CR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E11
Specificity
Recognizes human ALS2CR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ALS2CR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa319-418 from human ALS2CR2 (AAH08302) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of STRADB expression in transfected 293T cell line by ALS2CR2 monoclonal antibody. Lane 1: STRADB transfected lysate (47kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STRADB expression in transfected 293T cell line by ALS2CR2 monoclonal antibody. Lane 1: STRADB transfected lysate (47kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ALS2CR2 antibody
ALS2CR2, a novel anti-apoptotic protein, belongs to the serine/threonine protein kinase STE20 subfamily. Due to the presence of a protein kinase domain with one of the active site residues altered, ALS2CR2 is known as pseudokinase. ALS2CR2 is a component of a complex involved in the activation of a master kinase serine/threonine kinase 11, that regulates cell polarity and energy-generating metabolism and is known to regulate the relocation of this kinase from the nucleus to the cytoplasm. It is essential for G1 cell cycle arrest mediated by this kinase. ALS2CR2 is known to interact with the X chromosome-linked inhibitor of apoptosis protein, and thus enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway.
Product Categories/Family for anti-ALS2CR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
31,219 Da
NCBI Official Full Name
Homo sapiens STE20-related kinase adaptor beta, mRNA
NCBI Official Synonym Full Names
STE20-related kinase adaptor beta
NCBI Official Symbol
STRADB
NCBI Official Synonym Symbols
PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
NCBI Protein Information
STE20-related kinase adapter protein beta

NCBI Description

This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Research Articles on ALS2CR2

Similar Products

Product Notes

The ALS2CR2 (Catalog #AAA6145886) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALS2CR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALS2CR2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALS2CR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.