Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.4kD).)

Mouse anti-Human ALKBH3 Monoclonal Antibody | anti-ALKBH3 antibody

ALKBH3 (Alpha-ketoglutarate-dependent Dioxygenase alkB Homolog 3, Alkylated DNA Repair Protein alkB Homolog 3, DEPC-1, Prostate Cancer Antigen 1, ABH3, DEPC1, MGC118790, MGC118792, MGC118793) (PE)

Gene Names
ALKBH3; ABH3; PCA1; DEPC1; hABH3; DEPC-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALKBH3; Monoclonal Antibody; ALKBH3 (Alpha-ketoglutarate-dependent Dioxygenase alkB Homolog 3; Alkylated DNA Repair Protein alkB Homolog 3; DEPC-1; Prostate Cancer Antigen 1; ABH3; DEPC1; MGC118790; MGC118792; MGC118793) (PE); anti-ALKBH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A5-4F5
Specificity
Recognizes human DEPC-1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ALKBH3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-140 from human DEPC-1 (AAH15155) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.4kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.4kD).)

Western Blot (WB)

(DEPC-1 monoclonal antibody, Western Blot analysis of DEPC-1 expression in K-562.)

Western Blot (WB) (DEPC-1 monoclonal antibody, Western Blot analysis of DEPC-1 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged DEPC-1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DEPC-1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ALKBH3 antibody
Dioxygenase that repairs alkylated DNA containing 1-methyladenine (1meA) and 3-methylcytosine (3meC) by oxidative demethylation. Has a strong preference for single-stranded DNA. Able to process alkylated 3mC within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
Product Categories/Family for anti-ALKBH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
19,310 Da
NCBI Official Full Name
Homo sapiens alkB, alkylation repair homolog 3 (E. coli), mRNA
NCBI Official Synonym Full Names
alkB homolog 3, alpha-ketoglutaratedependent dioxygenase
NCBI Official Symbol
ALKBH3
NCBI Official Synonym Symbols
ABH3; PCA1; DEPC1; hABH3; DEPC-1
NCBI Protein Information
alpha-ketoglutarate-dependent dioxygenase alkB homolog 3

NCBI Description

The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]

Research Articles on ALKBH3

Similar Products

Product Notes

The ALKBH3 (Catalog #AAA6157425) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALKBH3 (Alpha-ketoglutarate-dependent Dioxygenase alkB Homolog 3, Alkylated DNA Repair Protein alkB Homolog 3, DEPC-1, Prostate Cancer Antigen 1, ABH3, DEPC1, MGC118790, MGC118792, MGC118793) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALKBH3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALKBH3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALKBH3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.