Mouse anti-Human ALDH1A1 Monoclonal Antibody | anti-ALDH1A1 antibody

ALDH1A1 (Retinal Dehydrogenase 1, RalDH1, RALDH 1, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase, Cytosolic, ALHDII, ALDH-E1, ALDH1A1, ALDC, ALDH1, PUMB1) (AP)

Cat. Num. AAA6129951

• Gene Names: ALDH1A1; ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ALDH1A1; Monoclonal Antibody; ALDH1A1 (Retinal Dehydrogenase 1; RalDH1; RALDH 1; Aldehyde Dehydrogenase Family 1 Member A1; Aldehyde Dehydrogenase; Cytosolic; ALHDII; ALDH-E1; ALDC; ALDH1; PUMB1) (AP); anti-ALDH1A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G6
• Specificity: Recognizes human ALDH1A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ALDH1A1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-501 from human ALDH1A1 (AAH01505) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (80.63kD).)

Western Blot (WB)

(Western Blot analysis of ALDH1A1 expression in transfected 293T cell line by ALDH1A1 monoclonal antibody. Lane 1: ALDH1A1 transfected lysate (54.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ALDH1A1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/m)

Immunoprecipitation (IP)

(Immunoprecipitation of ALDH1A1 transfected lysate using ALDH1A1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ALDH1A1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ALDH1A1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-ALDH1A1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 37589018
• NCBI GeneID: 216
• Molecular Weight: 54,862 Da
• NCBI Official Full Name: Homo sapiens aldehyde dehydrogenase 1 family, member A1, mRNA
• NCBI Official Synonym Full Names: aldehyde dehydrogenase 1 family member A1
• NCBI Official Symbol: ALDH1A1
• NCBI Official Synonym Symbols: ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
• NCBI Protein Information: retinal dehydrogenase 1
• Protein Family: Retinal dehydrogenase

NCBI Description

The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011]