Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ALDH1A1 rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse lung.)

Rabbit anti-Human, Mouse ALDH1A1 Polyclonal Antibody | anti-ALDH1A1 antibody

ALDH1A1 (Retinal Dehydrogenase 1, RalDH1, RALDH 1, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase, Cytosolic, ALHDII, ALDH-E1, ALDH1A1, ALDC, ALDH1, PUMB1) (AP)

Gene Names
ALDH1A1; ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALDH1A1; Polyclonal Antibody; ALDH1A1 (Retinal Dehydrogenase 1; RalDH1; RALDH 1; Aldehyde Dehydrogenase Family 1 Member A1; Aldehyde Dehydrogenase; Cytosolic; ALHDII; ALDH-E1; ALDC; ALDH1; PUMB1) (AP); anti-ALDH1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ALDH1A1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ALDH1A1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ALDH1A1, aa1-501 (NP_000680.2).
Immunogen Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ALDH1A1 rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse lung.)

Western Blot (WB) (ALDH1A1 rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse lung.)

Western Blot (WB)

(ALDH1A1 rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in HepG2)

Western Blot (WB) (ALDH1A1 rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in HepG2)

Western Blot (WB)

(Western Blot analysis of ALDH1A1 expression in transfected 293T cell line by ALDH1A1 polyclonal antibody. Lane 1: ALDH1A1 transfected lysate (54.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALDH1A1 expression in transfected 293T cell line by ALDH1A1 polyclonal antibody. Lane 1: ALDH1A1 transfected lysate (54.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ALDH1A1 antibody
ALDH1A1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme.
Product Categories/Family for anti-ALDH1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
216
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,862 Da
NCBI Official Full Name
retinal dehydrogenase 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family, member A1
NCBI Official Symbol
ALDH1A1
NCBI Official Synonym Symbols
ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
NCBI Protein Information
retinal dehydrogenase 1; ALDH class 1; ALHDII; RALDH 1; acetaldehyde dehydrogenase 1; aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase, liver cytosolic; epididymis luminal protein 12; epididymis luminal protein 9; epididymis secretory sperm bindi
UniProt Protein Name
Retinal dehydrogenase 1
Protein Family
UniProt Gene Name
ALDH1A1
UniProt Synonym Gene Names
ALDC; ALDH1; PUMB1; RALDH 1; RalDH1
UniProt Entry Name
AL1A1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011]

Uniprot Description

ALDH1A1: Binds free retinal and cellular retinol-binding protein- bound retinal. Can convert/oxidize retinaldehyde to retinoic acid. Belongs to the aldehyde dehydrogenase family.

Protein type: GAPs, Ras; EC 1.2.1.36; GAPs; Cofactor and Vitamin Metabolism - retinol; Apoptosis; Oxidoreductase

Chromosomal Location of Human Ortholog: 9q21.13

Cellular Component: cytoplasm; cytosol

Molecular Function: aldehyde dehydrogenase (NAD) activity; androgen binding; 3-chloroallyl aldehyde dehydrogenase activity; benzaldehyde dehydrogenase (NAD+) activity; retinal dehydrogenase activity

Biological Process: retinol metabolic process; xenobiotic metabolic process; aldehyde metabolic process; ethanol oxidation

Research Articles on ALDH1A1

Similar Products

Product Notes

The ALDH1A1 aldh1a1 (Catalog #AAA6369429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH1A1 (Retinal Dehydrogenase 1, RalDH1, RALDH 1, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase, Cytosolic, ALHDII, ALDH-E1, ALDH1A1, ALDC, ALDH1, PUMB1) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALDH1A1 aldh1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.