Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse AKT2 Monoclonal Antibody | anti-AKT2 antibody

AKT2 (v-akt Murine Thymoma Viral Oncogene Homolog 2, PKBB, PKBBETA, PRKBB, RAC-BETA) (Biotin)

Gene Names
AKT2; PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
AKT2; Monoclonal Antibody; AKT2 (v-akt Murine Thymoma Viral Oncogene Homolog 2; PKBB; PKBBETA; PRKBB; RAC-BETA) (Biotin); v-akt Murine Thymoma Viral Oncogene Homolog 2; RAC-BETA; anti-AKT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F3
Specificity
Recognizes AKT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
481
Applicable Applications for anti-AKT2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AKT2 (AAA58364, 100aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(AKT2 monoclonal antibody (M05), clone 1F3 Western Blot analysis of AKT2 expression in Jurkat.)

Western Blot (WB) (AKT2 monoclonal antibody (M05), clone 1F3 Western Blot analysis of AKT2 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in NIH/3T3.)

Western Blot (WB) (AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in NIH/3T3.)

Western Blot (WB)

(AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in PC-12.)

Western Blot (WB) (AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in PC-12.)
Related Product Information for anti-AKT2 antibody
This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. [provided by RefSeq]
Product Categories/Family for anti-AKT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
208
NCBI Official Full Name
protein serine/threonine kinase
NCBI Official Synonym Full Names
AKT serine/threonine kinase 2
NCBI Official Symbol
AKT2
NCBI Official Synonym Symbols
PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA
NCBI Protein Information
RAC-beta serine/threonine-protein kinase
Protein Family

NCBI Description

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of cancer cells For example, its overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins, and has also been implicated in insulin signaling. [provided by RefSeq, Nov 2019]

Research Articles on AKT2

Similar Products

Product Notes

The AKT2 (Catalog #AAA6172138) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AKT2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.