Mouse anti-Human AKAP8 Monoclonal Antibody | anti-AKAP8 antibody

AKAP8 (A-kinase Anchor Protein 8, AKAP-8, A-kinase Anchor Protein 95kD, AKAP 95, AKAP95, DKFZp586B1222) (PE)

Cat. Num. AAA6156450

• Gene Names: AKAP8; AKAP-8; AKAP95; AKAP 95; AKAP-95
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AKAP8; Monoclonal Antibody; AKAP8 (A-kinase Anchor Protein 8; AKAP-8; A-kinase Anchor Protein 95kD; AKAP 95; AKAP95; DKFZp586B1222) (PE); anti-AKAP8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D4
• Specificity: Recognizes human AKAP8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-AKAP8 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa551-662 from AKAP8 (NP_005849) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.43kD).)

Western Blot (WB)

(Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody Lane 1: AKAP8 transfected lysate (76.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of AKAP8 transfected lysate using AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.)

Western Blot (WB)

(AKAP8 monoclonal antibody (Western Blot analysis of AKAP8 expression in HeLa NE)

Product Categories/Family for anti-AKAP8 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5031579
• NCBI GeneID: 10270
• NCBI Accession #: NP_005849
• NCBI GenBank Nucleotide #: NM_005858
• UniProt Accession #: O43823
• Molecular Weight: 76kDa
• NCBI Official Full Name: A-kinase anchor protein 8
• NCBI Official Synonym Full Names: A-kinase anchoring protein 8
• NCBI Official Symbol: AKAP8
• NCBI Official Synonym Symbols: AKAP-8; AKAP95; AKAP 95; AKAP-95
• NCBI Protein Information: A-kinase anchor protein 8
• UniProt Protein Name: A-kinase anchor protein 8
• Protein Family: A-kinase anchor protein
• UniProt Gene Name: AKAP8
• UniProt Synonym Gene Names: AKAP95; AKAP-8; AKAP 95
• UniProt Entry Name: AKAP8_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subcellular locations. This gene encodes a nuclear A-kinase anchor protein that binds to the RII alpha subunit of PKA and may play a role in chromosome condensation during mitosis by targeting PKA and the condensin complex to chromatin. A pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, May 2011]

Uniprot Description

AKAP8: Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II). Belongs to the AKAP95 family.

Protein type: Mitochondrial; Cell cycle regulation; RNA-binding; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: nucleoplasm; Golgi apparatus; nuclear matrix; mitochondrion; membrane; condensed chromosome; female pronucleus; nucleus

Molecular Function: zinc ion binding; double-stranded DNA binding

Biological Process: mitosis; mitotic chromosome condensation; signal transduction