Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human, Rat AKAP13 Monoclonal Antibody | anti-AKAP13 antibody

AKAP13 (A-kinase Anchor Protein 13, AKAP-13, AKAP-Lbc, Breast Cancer Nuclear Receptor-binding Auxiliary Protein, Guanine Nucleotide Exchange Factor Lbc, Human Thyroid-anchoring Protein 31, Lymphoid Blast Crisis Oncogene, LBC Oncogene, Non-oncogenic Rho GT

Gene Names
AKAP13; BRX; LBC; p47; HA-3; Ht31; c-lbc; PRKA13; AKAP-13; AKAP-Lbc; ARHGEF13; PROTO-LB; PROTO-LBC
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP13; Monoclonal Antibody; AKAP13 (A-kinase Anchor Protein 13; AKAP-13; AKAP-Lbc; Breast Cancer Nuclear Receptor-binding Auxiliary Protein; Guanine Nucleotide Exchange Factor Lbc; Human Thyroid-anchoring Protein 31; Lymphoid Blast Crisis Oncogene; LBC Oncogene; Non-oncogenic Rho GT; anti-AKAP13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D6
Specificity
Recognizes human AKAP13. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2817
Applicable Applications for anti-AKAP13 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from AKAP13 (NP_006729) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(AKAP13 monoclonal antibody Western Blot analysis of AKAP13 expression in PC-12)

Western Blot (WB) (AKAP13 monoclonal antibody Western Blot analysis of AKAP13 expression in PC-12)

Western Blot (WB)

(AKAP13 monoclonal antibody Western Blot analysis of AKAP13 expression in K-562)

Western Blot (WB) (AKAP13 monoclonal antibody Western Blot analysis of AKAP13 expression in K-562)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AKAP13 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to AKAP13 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AKAP13 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AKAP13 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-AKAP13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A-kinase anchor protein 13 isoform 1
NCBI Official Synonym Full Names
A-kinase anchoring protein 13
NCBI Official Symbol
AKAP13
NCBI Official Synonym Symbols
BRX; LBC; p47; HA-3; Ht31; c-lbc; PRKA13; AKAP-13; AKAP-Lbc; ARHGEF13; PROTO-LB; PROTO-LBC
NCBI Protein Information
A-kinase anchor protein 13
UniProt Protein Name
A-kinase anchor protein 13
Protein Family
UniProt Gene Name
AKAP13
UniProt Synonym Gene Names
BRX; HT31; LBC; AKAP-13; LBC oncogene; PRKA13
UniProt Entry Name
AKP13_HUMAN

NCBI Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms containing c-terminal dbl oncogene homology (DH) and pleckstrin homology (PH) domains. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, resulting in the conversion of the inactive GTPase to the active form capable of transducing signals. The PH domain has multiple functions. Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway, function as protein kinase A-anchoring proteins and, in addition, enhance ligand-dependent activity of estrogen receptors alpha and beta. [provided by RefSeq, Jul 2012]

Uniprot Description

AKAP13: Anchors cAMP-dependent protein kinase (PKA) and acts as an adapter protein to selectively couple G alpha-13 and Rho. Augments gene activation by the estrogen receptor in an element- specific and ligand-dependent manner. Activates estrogen receptor beta by a p38 MAPK-dependent pathway. Stimulates exchange activity on Rho proteins in vitro, but not on CDC42, Ras or Rac and may bind calcium ions. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; GEFs, Rac/Rho; Nuclear export; GEFs; Oncoprotein; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 15q24-q25

Cellular Component: membrane; perinuclear region of cytoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; Rho guanyl-nucleotide exchange factor activity; signal transducer activity; Rho GTPase binding; cAMP-dependent protein kinase activity; metal ion binding; protein kinase A binding; protein complex scaffold

Biological Process: regulation of small GTPase mediated signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; small GTPase mediated signal transduction; nuclear export; regulation of protein kinase activity; protein amino acid phosphorylation

Research Articles on AKAP13

Similar Products

Product Notes

The AKAP13 akap13 (Catalog #AAA6135233) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP13 (A-kinase Anchor Protein 13, AKAP-13, AKAP-Lbc, Breast Cancer Nuclear Receptor-binding Auxiliary Protein, Guanine Nucleotide Exchange Factor Lbc, Human Thyroid-anchoring Protein 31, Lymphoid Blast Crisis Oncogene, LBC Oncogene, Non-oncogenic Rho GT reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP13 akap13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.