Mouse anti-Human, Mouse AKAP10 Monoclonal Antibody | anti-AKAP10 antibody

AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) (FITC)

Cat. Num. AAA6145837

• Gene Names: AKAP10; PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AKAP10; Monoclonal Antibody; AKAP10 (A-kinase Anchor Protein 10; Mitochondrial; AKAP-10; Dual Specificity A Kinase-anchoring Protein 2; D-AKAP-2; Protein Kinase A-anchoring Protein 10; PRKA10) (FITC); anti-AKAP10 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8C10
• Specificity: Recognizes human AKAP10. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-AKAP10 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 0.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from AKAP10 (NP_009133) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of AKAP10 expression in transfected 293T cell line using Cat. # 123131: Lane 1: AKAP10 transfected lysate (73.8kD); Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase staining of AKAP10 on formalin-fixed paraffin-embedded human testis using Cat. # 123131 at 0.5ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged AKAP10 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(RNAi Knockdown: Western blot analysis of AKAP10-over-expressing 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with Cat. # 123131. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(AKAP10 monoclonal antibody Western Blot analysis of AKAP10 expression in Raw 264.7.)

Product Categories/Family for anti-AKAP10 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21493033
• NCBI GeneID: 11216
• NCBI Accession #: NP_009133
• NCBI GenBank Nucleotide #: NM_007202
• UniProt Accession #: O43572
• Molecular Weight: 71kDa
• NCBI Official Full Name: A-kinase anchor protein 10, mitochondrial isoform 1
• NCBI Official Synonym Full Names: A-kinase anchoring protein 10
• NCBI Official Symbol: AKAP10
• NCBI Official Synonym Symbols: PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
• NCBI Protein Information: A-kinase anchor protein 10, mitochondrial
• UniProt Protein Name: A-kinase anchor protein 10, mitochondrial
• Protein Family: A-kinase anchor protein
• UniProt Gene Name: AKAP10
• UniProt Synonym Gene Names: AKAP-10; D-AKAP-2; PRKA10
• UniProt Entry Name: AKA10_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins bind to the regulatory subunits of protein kinase A (PKA) and confine the holoenzyme to discrete locations within the cell. The encoded protein is localized to mitochondria and interacts with both the type I and type II regulatory subunits of PKA. Polymorphisms in this gene may be associated with increased risk of arrhythmias and sudden cardiac death. [provided by RefSeq, May 2012]

Uniprot Description

AKAP10: Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A and anchors them to the mitochondria or the plasma membrane. Although the physiological relevance between PKA and AKAPS with mitochondria is not fully understood, one idea is that BAD, a proapoptotic member, is phosphorylated and inactivated by mitochondria-anchored PKA. It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for assembling multiprotein complexes. With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and the downstream kinase. Genetic variations in AKAP10 are a cause of susceptibility to sudden cardiac death (SCD). Unexpected rapid natural death due to cardiovascular collapse within one hour of initial symptoms. It is usually caused by the worsening of existing heart diseases. The sudden onset of symptoms, such as chest pain and cardiac arrhythmias, particularly ventricular tachycardia, can lead to the loss of consciousness and cardiac arrest followed by biological death. Increased susceptibility to sudden cardiac death may be conferred by AKAP10 variants that are associated with markers of low vagus nerve sensitivity, e.g. fast basal heart rate and low heart rate variability.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17p11.1

Cellular Component: mitochondrion; cytoplasm; plasma membrane; cytosol

Biological Process: protein localization; signal transduction; blood coagulation

Disease: Cardiac Conduction Defect