Mouse AK1 Monoclonal Antibody | anti-AK1 antibody

AK1 (Adenylate Kinase 1) (AP)

Cat. Num. AAA6161953

• Gene Names: AK1; HTL-S-58j
• Applications: Western Blot
• Purity: Purified
• Synonyms: AK1; Monoclonal Antibody; AK1 (Adenylate Kinase 1) (AP); Adenylate Kinase 1; anti-AK1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M1
• Specificity: Recognizes AK1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 194

• Applicable Applications for anti-AK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: AK1 (AAH01116, 1aa-194aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AK1 monoclonal antibody (M08), clone M1 Western Blot analysis of AK1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 20 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AK1 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-AK1 antibody

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq]

Product Categories/Family for anti-AK1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 12654563
• NCBI GeneID: 203
• NCBI Official Full Name: Adenylate kinase 1
• NCBI Official Synonym Full Names: adenylate kinase 1
• NCBI Official Symbol: AK1
• NCBI Official Synonym Symbols: HTL-S-58j
• NCBI Protein Information: adenylate kinase isoenzyme 1
• Protein Family: Adenylate kinase

NCBI Description

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]