Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ADH4 Monoclonal Antibody | anti-ADH4 antibody

ADH4 (Alcohol Dehydrogenase 4 (Class II), Pi Polypeptide, ADH-2) (Biotin)

Gene Names
ADH4; ADH-2; HEL-S-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ADH4; Monoclonal Antibody; ADH4 (Alcohol Dehydrogenase 4 (Class II); Pi Polypeptide; ADH-2) (Biotin); anti-ADH4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C5
Specificity
Recognizes human ADH4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ADH4 antibody
ELISA (EIA), Western Blot (WB), RNAi Knockdown
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa52-150 from human ADH4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ADH4 antibody
This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Product Categories/Family for anti-ADH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
127
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
alcohol dehydrogenase 4 isoform 2
NCBI Official Synonym Full Names
alcohol dehydrogenase 4 (class II), pi polypeptide
NCBI Official Symbol
ADH4
NCBI Official Synonym Symbols
ADH-2; HEL-S-4
NCBI Protein Information
alcohol dehydrogenase 4
UniProt Protein Name
Alcohol dehydrogenase 4
Protein Family
UniProt Gene Name
ADH4

NCBI Description

This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq, Jul 2008]

Uniprot Description

ADH4: class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq, Jul 2008]

Protein type: Amino Acid Metabolism - tyrosine; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Cofactor and Vitamin Metabolism - retinol; EC 1.1.1.1; Lipid Metabolism - fatty acid; Oxidoreductase; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: cytosol

Molecular Function: alcohol dehydrogenase activity; alcohol dehydrogenase activity, zinc-dependent; all-trans retinal binding; benzaldehyde dehydrogenase activity; NAD binding; NADPH:quinone reductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor; retinol binding; retinol dehydrogenase activity; zinc ion binding

Biological Process: alcohol catabolic process; alcohol metabolic process; aldehyde metabolic process; ethanol oxidation; retinoid metabolic process; retinol metabolic process

Research Articles on ADH4

Similar Products

Product Notes

The ADH4 adh4 (Catalog #AAA6145335) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADH4 (Alcohol Dehydrogenase 4 (Class II), Pi Polypeptide, ADH-2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADH4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), RNAi Knockdown. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADH4 adh4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADH4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.