Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ADCY5 Monoclonal Antibody | anti-ADCY5 antibody

ADCY5 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5)

Gene Names
ADCY5; AC5; FDFM
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ADCY5; Monoclonal Antibody; ADCY5 (Adenylate Cyclase Type 5; ATP Pyrophosphate-lyase 5; Adenylate Cyclase Type V; Adenylyl Cyclase 5); Anti -ADCY5 (Adenylate Cyclase Type 5; anti-ADCY5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E6
Specificity
Recognizes human ADCY5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Applicable Applications for anti-ADCY5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1152-1262 from human ADCY5 (NP_899200) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ADCY5 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADCY5 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ADCY5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
111
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138,908 Da
NCBI Official Full Name
adenylate cyclase type 5 isoform 2
NCBI Official Synonym Full Names
adenylate cyclase 5
NCBI Official Symbol
ADCY5
NCBI Official Synonym Symbols
AC5; FDFM
NCBI Protein Information
adenylate cyclase type 5; adenylyl cyclase 5; adenylate cyclase type V; ATP pyrophosphate-lyase 5
UniProt Protein Name
Adenylate cyclase type 5
Protein Family
UniProt Gene Name
ADCY5
UniProt Entry Name
ADCY5_HUMAN

NCBI Description

This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

ADCY5: This is a membrane-bound, calcium-inhibitable adenylyl cyclase. Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Nucleotide Metabolism - purine; Lyase; Adenylyl cyclase; Membrane protein, integral; Transporter, aquaporin family; Transporter; EC 4.6.1.1

Chromosomal Location of Human Ortholog: 3q21.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein heterodimerization activity; metal ion binding; ATP binding; adenylate cyclase activity; adenylate cyclase binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; water transport; activation of protein kinase A; locomotory behavior; signal transduction; G-protein signaling, adenylate cyclase activating pathway; dopamine receptor, adenylate cyclase inhibiting pathway; synaptic transmission; phospholipase C activation; energy reserve metabolic process; renal water homeostasis; innate immune response; cAMP biosynthetic process; G-protein signaling, adenylate cyclase inhibiting pathway; neuromuscular process controlling balance; adenosine receptor signaling pathway; transmembrane transport; dopamine receptor, adenylate cyclase activating pathway

Disease: Dyskinesia, Familial, With Facial Myokymia

Research Articles on ADCY5

Similar Products

Product Notes

The ADCY5 adcy5 (Catalog #AAA6003988) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADCY5 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADCY5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ADCY5 adcy5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ADFAMKLMDQ MKYINEHSFN NFQMKIGLNI GPVVAGVIGA RKPQYDIWGN TVNVASRMDS TGVPDRIQVT TDMYQVLAAN TYQLECRGVV KVKGKGEMMT YFLNGGPPLS. It is sometimes possible for the material contained within the vial of "ADCY5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.