Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLR3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit POLR3A Polyclonal Antibody | anti-POLR3A antibody

POLR3A antibody - middle region

Gene Names
POLR3A; ADDH; HLD7; RPC1; WDRTS; RPC155; hRPC155
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR3A; Polyclonal Antibody; POLR3A antibody - middle region; anti-POLR3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
Sequence Length
1390
Applicable Applications for anti-POLR3A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%; Yeast: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POLR3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLR3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-POLR3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-POLR3A antibody
This is a rabbit polyclonal antibody against POLR3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
156kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC1
NCBI Official Synonym Full Names
RNA polymerase III subunit A
NCBI Official Symbol
POLR3A
NCBI Official Synonym Symbols
ADDH; HLD7; RPC1; WDRTS; RPC155; hRPC155
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC1
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC1
UniProt Gene Name
POLR3A
UniProt Synonym Gene Names
RNA polymerase III subunit C1; RPC155
UniProt Entry Name
RPC1_HUMAN

NCBI Description

The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response. [provided by RefSeq, Aug 2011]

Uniprot Description

POLR3A: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Defects in POLR3A are the cause of leukodystrophy hypomyelinating type 7 with or without oligodontia and/or hypogonadotropic hypogonadism (HLD7). An autosomal recessive neurodegenerative disorder characterized by childhood onset of progressive motor decline manifest as spasticity, ataxia, tremor, and cerebellar signs, as well as mild cognitive regression. Other features may include hypodontia or oligodontia and hypogonadotropic hypogonadism. There is considerable inter- and intrafamilial variability. Belongs to the RNA polymerase beta' chain family.

Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Transcription initiation complex; Transferase; EC 2.7.7.6

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; membrane; cytosol

Molecular Function: DNA binding; zinc ion binding; ribonucleoside binding; DNA-directed RNA polymerase activity; chromatin binding

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; transcription, DNA-dependent; positive regulation of interferon type I production; positive regulation of interferon-beta production; innate immune response; gene expression; defense response to virus; RNA elongation from RNA polymerase III promoter

Disease: Leukodystrophy, Hypomyelinating, 7, With Or Without Oligodontia And/or Hypogonadotropic Hypogonadism

Research Articles on POLR3A

Similar Products

Product Notes

The POLR3A polr3a (Catalog #AAA3209140) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR3A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's POLR3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR3A polr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AYFGQKDSVC GVSECIIMGI PMNIGTGLFK LLHKADRDPN PPKRPLIFDT. It is sometimes possible for the material contained within the vial of "POLR3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.