Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ADCY2 is ~1ng/ml as a capture antibody.)

Mouse anti-Human ADCY2 Monoclonal Antibody | anti-ADCY2 antibody

ADCY2 (Adenylate Cyclase Type 2, Adenylate Cyclase Type II, ATP Pyrophosphate-lyase 2, Adenylyl Cyclase 2, ADCY2, KIAA1060) (FITC)

Gene Names
ADCY2; AC2; HBAC2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADCY2; Monoclonal Antibody; ADCY2 (Adenylate Cyclase Type 2; Adenylate Cyclase Type II; ATP Pyrophosphate-lyase 2; Adenylyl Cyclase 2; KIAA1060) (FITC); anti-ADCY2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D4
Specificity
Recognizes human ADCY2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ADCY2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa977-1086 from human ADCY2 (NP_065433) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADCY2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADCY2 is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GNAS and ADCY2. HeLa cells were stained with GNAS rabbit purified polyclonal 1:1200 and ADCY2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GNAS and ADCY2. HeLa cells were stained with GNAS rabbit purified polyclonal 1:1200 and ADCY2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ADCY2 antibody
ADCY2 is a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate(cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex.
Product Categories/Family for anti-ADCY2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
108
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103,158 Da
NCBI Official Full Name
adenylate cyclase type 2
NCBI Official Synonym Full Names
adenylate cyclase 2 (brain)
NCBI Official Symbol
ADCY2
NCBI Official Synonym Symbols
AC2; HBAC2
NCBI Protein Information
adenylate cyclase type 2; 3',5'-cyclic AMP synthetase; ATP pyrophosphate-lyase 2; adenylate cyclase II; adenylate cyclase type II; adenylyl cyclase 2; type II adenylate cyclase
UniProt Protein Name
Adenylate cyclase type 2
Protein Family
UniProt Gene Name
ADCY2
UniProt Synonym Gene Names
KIAA1060

Uniprot Description

Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:15385642). Down-stream signaling cascades mediate changes in gene expression patterns and lead to increased IL6 production. Functions in signaling cascades downstream of the muscarinic acetylcholine receptors ().

Similar Products

Product Notes

The ADCY2 adcy2 (Catalog #AAA6145799) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADCY2 (Adenylate Cyclase Type 2, Adenylate Cyclase Type II, ATP Pyrophosphate-lyase 2, Adenylyl Cyclase 2, ADCY2, KIAA1060) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADCY2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADCY2 adcy2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADCY2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.