Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ADAMTS15 is 0.03 ng/ml as a capture antibody.)

Mouse ADAMTS15 Monoclonal Antibody | anti-ADAMTS15 antibody

ADAMTS15 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif, 15, MGC126403) (FITC)

Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ADAMTS15; Monoclonal Antibody; ADAMTS15 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif; 15; MGC126403) (FITC); ADAM Metallopeptidase with Thrombospondin Type 1 Motif; MGC126403; anti-ADAMTS15 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F3
Specificity
Recognizes ADAMTS15.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
950
Applicable Applications for anti-ADAMTS15 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ADAMTS15 (NP_620686, 863aa-950aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADAMTS15 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAMTS15 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-ADAMTS15 antibody
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the proteins encoded by ADAMTS1 and ADAMTS8. [provided by RefSeq]
Product Categories/Family for anti-ADAMTS15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 15 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 15
NCBI Official Symbol
ADAMTS15
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 15
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 15
UniProt Gene Name
ADAMTS15
UniProt Synonym Gene Names
ADAM-TS 15; ADAM-TS15; ADAMTS-15
UniProt Entry Name
ATS15_HUMAN

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme, which may play a role in versican processing during skeletal muscle development. This gene may function as a tumor suppressor in colorectal and breast cancers. [provided by RefSeq, May 2016]

Uniprot Description

ADAMTS15:

Protein type: Protease; Motility/polarity/chemotaxis; Extracellular matrix; EC 3.4.24.-; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q25

Cellular Component: proteinaceous extracellular matrix

Molecular Function: zinc ion binding; metalloendopeptidase activity

Biological Process: proteolysis

Research Articles on ADAMTS15

Similar Products

Product Notes

The ADAMTS15 adamts15 (Catalog #AAA6179140) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ADAMTS15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAMTS15 adamts15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAMTS15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.