Mouse anti-Human NOP16 Monoclonal Antibody | anti-NOP16 antibody

NOP16 (Nucleolar Protein 16, HBV pre-S2 Trans-regulated Protein 3, CGI-117, HSPC111)

Cat. Num. AAA6011676

• Gene Names: NOP16; HSPC111; HSPC185
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NOP16; Monoclonal Antibody; NOP16 (Nucleolar Protein 16; HBV pre-S2 Trans-regulated Protein 3; CGI-117; HSPC111); Anti -NOP16 (Nucleolar Protein 16; anti-NOP16 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G4
• Specificity: Recognizes human HSPC111.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

• Applicable Applications for anti-NOP16 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length recombinant corresponding to aa1-179 from human HSPC111 (AAH40106) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.69kD).)

Western Blot (WB)

(HSPC111 monoclonal antibody, Western Blot analysis of HSPC111 expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HSPC111 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSPC111 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HSPC111 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-NOP16 antibody

Belongs to the NOP16 family.

Product Categories/Family for anti-NOP16 antibody

Antibodies; Abs to Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 374858054
• NCBI GeneID: 51491
• NCBI Accession #: NP_001243469.1
• NCBI GenBank Nucleotide #: NM_001256540.1
• UniProt Accession #: Q9Y3C1; Q05D05; Q6IAI6; Q8IXL5; B4DV13; D6RGD3
• Molecular Weight: 21,188 Da
• NCBI Official Full Name: nucleolar protein 16 isoform 2
• NCBI Official Synonym Full Names: NOP16 nucleolar protein
• NCBI Official Symbol: NOP16
• NCBI Official Synonym Symbols: HSPC111; HSPC185
• NCBI Protein Information: nucleolar protein 16; hypothetical protein HSPC111; nucleolar protein 16 homolog; NOP16 nucleolar protein homolog; HBV pre-S2 trans-regulated protein 3
• UniProt Protein Name: Nucleolar protein 16
• Protein Family: Nucleolar protein
• UniProt Gene Name: NOP16
• UniProt Entry Name: NOP16_HUMAN

NCBI Description

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM, Jun 2009]

Uniprot Description

HSPC111: Belongs to the NOP16 family

Protein type: RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: intracellular membrane-bound organelle; nucleolus; nucleus

Biological Process: ribosomal large subunit biogenesis and assembly