Testing Data
(Detection limit for recombinant GST tagged ADAMTS13 is ~0.1ng/ml using 122979 as a capture antibody.)
Mouse anti-Human ADAMTS13 Monoclonal Antibody | anti-ADAMTS13 antibody
ADAMTS13 (von Willebrand Factor-cleaving Protease, vWF-cleaving Protease, vWF-CP, A Disintegrin And Metalloproteinase With Thrombospondin Motifs 13, ADAMTS-13, ADAM-TS 13, ADAM-TS13, UNQ6102/PRO20085, C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900)
Gene Names
ADAMTS13; VWFCP; C9orf8; vWF-CP; ADAM-TS13; ADAMTS-13
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAMTS13; Monoclonal Antibody; ADAMTS13 (von Willebrand Factor-cleaving Protease; vWF-cleaving Protease; vWF-CP; A Disintegrin And Metalloproteinase With Thrombospondin Motifs 13; ADAMTS-13; ADAM-TS 13; ADAM-TS13; UNQ6102/PRO20085; C9orf8; DKFZp434C2322; FLJ42993; MGC118899; MGC118900); anti-ADAMTS13 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F12
Specificity
Recognizes human ADAMTS13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1427
Applicable Applications for anti-ADAMTS13 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1328-1427 from human ADAMTS13 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ADAMTS13 is ~0.1ng/ml using 122979 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ADAMTS13 is ~0.1ng/ml using 122979 as a capture antibody.)
Related Product Information for anti-ADAMTS13 antibody
ADAMTS13 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura.
Product Categories/Family for anti-ADAMTS13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform 1 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 13
NCBI Official Symbol
ADAMTS13
NCBI Official Synonym Symbols
VWFCP; C9orf8; vWF-CP; ADAM-TS13; ADAMTS-13
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 13
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 13
UniProt Gene Name
ADAMTS13
UniProt Synonym Gene Names
C9orf8; ADAM-TS 13; ADAM-TS13; ADAMTS-13; vWF-CP; vWF-cleaving protease
NCBI Description
This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Uniprot Description
Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.
Research Articles on ADAMTS13
Similar Products
Product Notes
The ADAMTS13 adamts13 (Catalog #AAA6129883) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAMTS13 (von Willebrand Factor-cleaving Protease, vWF-cleaving Protease, vWF-CP, A Disintegrin And Metalloproteinase With Thrombospondin Motifs 13, ADAMTS-13, ADAM-TS 13, ADAM-TS13, UNQ6102/PRO20085, C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMTS13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAMTS13 adamts13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAMTS13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
