Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ADAM2 is 1 ng/ml as a capture antibody.)

Mouse ADAM2 Monoclonal Antibody | anti-ADAM2 antibody

ADAM2 (ADAM Metallopeptidase Domain 2, CRYN1, CRYN2, FTNB, PH-30b, PH30) (HRP)

Gene Names
ADAM2; CT15; FTNB; PH30; CRYN1; CRYN2; PH-30b; PH30-beta
Applications
Western Blot
Purity
Purified
Synonyms
ADAM2; Monoclonal Antibody; ADAM2 (ADAM Metallopeptidase Domain 2; CRYN1; CRYN2; FTNB; PH-30b; PH30) (HRP); ADAM Metallopeptidase Domain 2; PH30; anti-ADAM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B8
Specificity
Recognizes ADAM2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ADAM2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ADAM2 (NP_001455, 376aa-475aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADAM2 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAM2 is 1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of ADAM2 expression in transfected 293T cell line by ADAM2 monoclonal antibody (M02), clone 1B8.Lane 1: ADAM2 transfected lysate (Predicted MW: 64.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ADAM2 expression in transfected 293T cell line by ADAM2 monoclonal antibody (M02), clone 1B8.Lane 1: ADAM2 transfected lysate (Predicted MW: 64.8 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ADAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 2 isoform 1 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 2
NCBI Official Symbol
ADAM2
NCBI Official Synonym Symbols
CT15; FTNB; PH30; CRYN1; CRYN2; PH-30b; PH30-beta
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 2
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 2
UniProt Gene Name
ADAM2
UniProt Synonym Gene Names
FTNB; ADAM 2; CT15; PH30
UniProt Entry Name
ADAM2_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

ADAM2: a member of the ADAM (a disintegrin and metalloprotease domain) family of Cancer-Testis Antigen (CTAs) . CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovary cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. A sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein. Two isoforms of the human protein are produced by alternative splicing. Note: This description may include information from RefSeq and UniProtKB

Protein type: Motility/polarity/chemotaxis; Cell surface; Cancer Testis Antigen (CTA); Membrane protein, integral

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: cell surface; integral to plasma membrane; plasma membrane

Molecular Function: integrin binding; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity

Biological Process: fusion of sperm to egg plasma membrane; binding of sperm to zona pellucida; single fertilization; adult behavior; visual learning; proteolysis; cell adhesion; multicellular organism reproduction

Research Articles on ADAM2

Similar Products

Product Notes

The ADAM2 adam2 (Catalog #AAA6182719) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ADAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAM2 adam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.