Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (49.43kD).)

Mouse anti-Human ACOT9 Monoclonal Antibody | anti-ACOT9 antibody

ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (PE)

Gene Names
ACOT9; ACATE2; CGI-16; MTACT48; MT-ACT48
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACOT9; Monoclonal Antibody; ACOT9 (Acyl CoA Thioester Hydrolase 9; Acyl Coenzyme A Thioesterase 9; Acyl CoA Thioesterase 9; ACATE2; CGI-16; MT-ACT48) (PE); anti-ACOT9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E4
Specificity
Recognizes human ACATE2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ACOT9 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-213 from ACATE2 (AAH12573) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (49.43kD).)

Western Blot (WB)

(Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody. Lane 1: ACOT9 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody. Lane 1: ACOT9 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ACOT9 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACOT9 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(ACATE2 monoclonal antibody Western Blot analysis of ACATE2 expression in MCF-7.)

Western Blot (WB) (ACATE2 monoclonal antibody Western Blot analysis of ACATE2 expression in MCF-7.)
Product Categories/Family for anti-ACOT9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
50,851 Da
NCBI Official Full Name
Homo sapiens acyl-CoA thioesterase 9, mRNA
NCBI Official Synonym Full Names
acyl-CoA thioesterase 9
NCBI Official Symbol
ACOT9
NCBI Official Synonym Symbols
ACATE2; CGI-16; MTACT48; MT-ACT48
NCBI Protein Information
acyl-coenzyme A thioesterase 9, mitochondrial

NCBI Description

The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Similar Products

Product Notes

The ACOT9 (Catalog #AAA6156357) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACOT9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACOT9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.