Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ACAP2 Monoclonal Antibody | anti-ACAP2 antibody

ACAP2 (Arf-GAP with Coiled-coil, ANK Repeat and PH Domain-containing Protein 2, Centaurin-beta-2, Cnt-b2, CENTB2, KIAA0041) (MaxLight 750)

Gene Names
ACAP2; CENTB2; CNT-B2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACAP2; Monoclonal Antibody; ACAP2 (Arf-GAP with Coiled-coil; ANK Repeat and PH Domain-containing Protein 2; Centaurin-beta-2; Cnt-b2; CENTB2; KIAA0041) (MaxLight 750); anti-ACAP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G3
Specificity
Recognizes human CENTB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ACAP2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa473-582 from CENTB2 (NP_036419) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVS*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ACAP2 antibody
Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane.
Product Categories/Family for anti-ACAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
NCBI Official Synonym Full Names
ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
NCBI Official Symbol
ACAP2
NCBI Official Synonym Symbols
CENTB2; CNT-B2
NCBI Protein Information
arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
UniProt Protein Name
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
UniProt Gene Name
ACAP2
UniProt Synonym Gene Names
CENTB2; KIAA0041; Cnt-b2
UniProt Entry Name
ACAP2_HUMAN

Uniprot Description

CENTB2: a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins. Regulates cytoskeletal and membrane trafficking events in the cell periphery. Binding of phosphoinositides to a pleckstrin homology domain may regulate subcellular localization and activity.

Protein type: GAPs, ARF; Motility/polarity/chemotaxis; GAPs

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: membrane; endosome membrane

Molecular Function: zinc ion binding; Rab GTPase binding

Biological Process: positive regulation of GTPase activity

Research Articles on ACAP2

Similar Products

Product Notes

The ACAP2 acap2 (Catalog #AAA6231393) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACAP2 (Arf-GAP with Coiled-coil, ANK Repeat and PH Domain-containing Protein 2, Centaurin-beta-2, Cnt-b2, CENTB2, KIAA0041) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACAP2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACAP2 acap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACAP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.