Mouse anti-Human ACAP2 Monoclonal Antibody | anti-ACAP2 antibody

ACAP2 (Arf-GAP with Coiled-coil, ANK Repeat and PH Domain-containing Protein 2, Centaurin-beta-2, Cnt-b2, CENTB2, KIAA0041) (FITC)

Cat. Num. AAA6145739

• Gene Names: ACAP2; CENTB2; CNT-B2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACAP2; Monoclonal Antibody; ACAP2 (Arf-GAP with Coiled-coil; ANK Repeat and PH Domain-containing Protein 2; Centaurin-beta-2; Cnt-b2; CENTB2; KIAA0041) (FITC); anti-ACAP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4G3
• Specificity: Recognizes human CENTB2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ACAP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa473-582 from CENTB2 (NP_036419) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVS*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(CENTB2 monoclonal antibody Western Blot analysis of CENTB2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ACAP2 expression in transfected 293T cell line by ACAP2 monoclonal antibody. Lane 1: ACAP2 transfected lysate (Predicted MW: 88.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of ACAP2 transfected lysate using ACAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACAP2 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CENTB2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-ACAP2 antibody

Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane.

Product Categories/Family for anti-ACAP2 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 187608516
• NCBI GeneID: 23527
• NCBI Accession #: NP_036419
• NCBI GenBank Nucleotide #: NM_012287
• UniProt Accession #: Q15057
• Molecular Weight: 85kDa
• NCBI Official Full Name: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
• NCBI Official Synonym Full Names: ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
• NCBI Official Symbol: ACAP2
• NCBI Official Synonym Symbols: CENTB2; CNT-B2
• NCBI Protein Information: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
• UniProt Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
• Protein Family: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
• UniProt Gene Name: ACAP2
• UniProt Synonym Gene Names: CENTB2; KIAA0041; Cnt-b2
• UniProt Entry Name: ACAP2_HUMAN

Uniprot Description

CENTB2: a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins. Regulates cytoskeletal and membrane trafficking events in the cell periphery. Binding of phosphoinositides to a pleckstrin homology domain may regulate subcellular localization and activity.

Protein type: GAPs, ARF; Motility/polarity/chemotaxis; GAPs

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: membrane; endosome membrane

Molecular Function: zinc ion binding; Rab GTPase binding

Biological Process: positive regulation of GTPase activity