Matrilysin (MMP7) Recombinant Protein | MMP7 recombinant protein

Recombinant Human Matrilysin (MMP7)

Cat. Num. AAA954870

• Gene Names: MMP7; MMP-7; MPSL1; PUMP-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Matrilysin (MMP7); Recombinant Human Matrilysin (MMP7); MMP7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 95-267aa, Full Length of Mature Protein
• Sequence: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
• Sequence Length: 267

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for MMP7 recombinant protein

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

NCBI and Uniprot Product Information

• NCBI GI #: 4505219
• NCBI GeneID: 4316
• NCBI Accession #: NP_002414.1
• NCBI GenBank Nucleotide #: NM_002423.4
• UniProt Accession #: P09237; Q9BTK9
• Molecular Weight: 46.1 kDa
• NCBI Official Full Name: matrilysin preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 7
• NCBI Official Symbol: MMP7
• NCBI Official Synonym Symbols: MMP-7; MPSL1; PUMP-1
• NCBI Protein Information: matrilysin
• UniProt Protein Name: Matrilysin
• Protein Family: Matrilysin
• UniProt Gene Name: MMP7
• UniProt Synonym Gene Names: MPSL1; PUMP1; MMP-7

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers. [provided by RefSeq, Jan 2016]

Uniprot Description

Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.