Matrix metalloproteinase-23 (Mmp23) Recombinant Protein | Mmp23 recombinant protein
Recombinant Mouse Matrix metalloproteinase-23 (Mmp23), partial
Gene Names
Mmp23; CA-MMP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-23 (Mmp23); Recombinant Mouse Matrix metalloproteinase-23 (Mmp23); partial; Mmp23 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
80-391
Sequence
YTLTPARLRWDHFNLTYRVLSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAQLSIIANAVNEGTYTCVVRRHQRVLSTYSWRVRVRN
Sequence Length
391
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,946 Da
NCBI Official Full Name
matrix metalloproteinase-23 isoform 2
NCBI Official Synonym Full Names
matrix metallopeptidase 23
NCBI Official Symbol
Mmp23
NCBI Official Synonym Symbols
CA-MMP
NCBI Protein Information
matrix metalloproteinase-23
UniProt Protein Name
Matrix metalloproteinase-23
Protein Family
UniProt Gene Name
Mmp23
UniProt Synonym Gene Names
Cammp; MMP-23; CA-MMP; CAMP metalloproteinase
NCBI Description
This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded protein contains an N-terminal cysteine array and a novel immunoglobulin-fold domain at the C-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing. [provided by RefSeq, Feb 2016]
Uniprot Description
Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum ().
Similar Products
Product Notes
The Mmp23 mmp23 (Catalog #AAA1102178) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 80-391. The amino acid sequence is listed below: YTLTPARLRW DHFNLTYRVL SFPRNLLSPE ETRRGLAAAF RMWSDVSPFS FREVAPERPS DLKIGFYPVN HTDCLVSAVH HCFDGPTGEL AHAFFPPHGG IHFDDSEYWV LGPTRYSWKK GVWLTNLVHV AAHEIGHALG LMHSQQDQAL MHLNATLRGW KALSQDELWG LHRLYGCLDR IFVCASWARK GFCDVRQRLM KRLCPRSCDF CYEFPFPTVA TTTSPTRTKT RLVREGRNMT FHCGQKILHK KGKVYWYKDQ EPLEFSYPGY LALGEAQLSI IANAVNEGTY TCVVRRHQRV LSTYSWRVRV RN. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-23 (Mmp23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
