Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Mixed lineage kinase domain-like protein (Mlkl) Recombinant Protein | Mlkl recombinant protein

Recombinant Mouse Mixed lineage kinase domain-like protein (Mlkl)

Gene Names
Mlkl; 9130019I15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mixed lineage kinase domain-like protein (Mlkl); Recombinant Mouse Mixed lineage kinase domain-like protein (Mlkl); Mlkl recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-472aa; Full Length
Sequence
MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRSLSGRERILERLSAVEESTDKKV
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56.3 kDa
NCBI Official Full Name
mixed lineage kinase domain-like protein isoform 1
NCBI Official Synonym Full Names
mixed lineage kinase domain-like
NCBI Official Symbol
Mlkl
NCBI Official Synonym Symbols
9130019I15Rik
NCBI Protein Information
mixed lineage kinase domain-like protein
UniProt Protein Name
Mixed lineage kinase domain-like protein
UniProt Gene Name
Mlkl

NCBI Description

This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage. Does not have protein kinase activity.

Research Articles on Mlkl

Similar Products

Product Notes

The Mlkl mlkl (Catalog #AAA1379843) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472aa; Full Length. The amino acid sequence is listed below: MDKLGQIIKL GQLIYEQCEK MKYCRKQCQR LGNRVHGLLQ PLQRLQAQGK KNLPDDITAA LGRFDEVLKE ANQQIEKFSK KSHIWKFVSV GNDKILFHEV NEKLRDVWEE LLLLLQVYHW NTVSDVSQPA SWQQEDRQDA EEDGNENMKV ILMQLQISVE EINKTLKQCS LKPTQEIPQD LQIKEIPKEH LGPPWTKLKT SKMSTIYRGE YHRSPVTIKV FNNPQAESVG IVRFTFNDEI KTMKKFDSPN ILRIFGICID QTVKPPEFSI VMEYCELGTL RELLDREKDL TMSVRSLLVL RAARGLYRLH HSETLHRNIS SSSFLVAGGY QVKLAGFELS KTQNSISRTA KSTKAERSSS TIYVSPERLK NPFCLYDIKA EIYSFGIVLW EIATGKIPFE GCDSKKIREL VAEDKKQEPV GQDCPELLRE IINECRAHEP SQRPSVDGRS LSGRERILER LSAVEESTDK KV . It is sometimes possible for the material contained within the vial of "Mixed lineage kinase domain-like protein (Mlkl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.