Probable cell division topological determinant MinJ (minJ) Recombinant Protein | minJ recombinant protein
Recombinant Lactobacillus casei Probable cell division topological determinant MinJ (minJ), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable cell division topological determinant MinJ (minJ); Recombinant Lactobacillus casei Probable cell division topological determinant MinJ (minJ); partial; minJ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-367
Sequence
MAVVVALLINPVGLVFWLALGLTIWFAVNRTDRERRRYLRAIHPKHPEIGRFFWIGLVVGALVSLVMVIGRLQISLAALLALSGLTLVALLFSKWRFSPWWLGLASLAAVGQSGLLAEQHAANLAILVGLLWLTQAGLARFNRGDEIESPVIQQDRRQRQSAAFELRQLFWVPLILPVAVENVSNLPLLAVTVQSLTFVGLPLLLGATFMTPRDRAQTAWRRSWPWYGGAGGVLIVYGIVARTMTLPLLVSLVFPAVVSLVLVGGFIWQGRQVHLTVTLADQGVVLIGVVPHTPAAEMGLQPGDRVLACNHHSVNNSRELYDAIQKEPTYCRLRLRQADGELRLAETAIFAGAPHELGMILFPEETA
Sequence Length
367
Species
Lactobacillus casei (strain LC2W)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,349 Da
NCBI Official Full Name
MULTISPECIES: cell division topological determinant MinJ
UniProt Protein Name
Probable cell division topological determinant MinJ
Protein Family
UniProt Gene Name
minJ
UniProt Synonym Gene Names
yvjD
Uniprot Description
The main function of the Min system is to promote the disassembly of the cytokinetic ring after cell division, thereby ensuring that division occurs only once per cell cycle. MinJ acts as a bridge between DivIVA and MinD. May modulate activity and localization of MinD and MinC through direct interaction with MinD ().
Similar Products
Product Notes
The minJ minj (Catalog #AAA1064423) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-367. The amino acid sequence is listed below: MAVVVALLIN PVGLVFWLAL GLTIWFAVNR TDRERRRYLR AIHPKHPEIG RFFWIGLVVG ALVSLVMVIG RLQISLAALL ALSGLTLVAL LFSKWRFSPW WLGLASLAAV GQSGLLAEQH AANLAILVGL LWLTQAGLAR FNRGDEIESP VIQQDRRQRQ SAAFELRQLF WVPLILPVAV ENVSNLPLLA VTVQSLTFVG LPLLLGATFM TPRDRAQTAW RRSWPWYGGA GGVLIVYGIV ARTMTLPLLV SLVFPAVVSL VLVGGFIWQG RQVHLTVTLA DQGVVLIGVV PHTPAAEMGL QPGDRVLACN HHSVNNSREL YDAIQKEPTY CRLRLRQADG ELRLAETAIF AGAPHELGMI LFPEETA. It is sometimes possible for the material contained within the vial of "Probable cell division topological determinant MinJ (minJ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
