Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Macrophage migration inhibitory factor Recombinant Protein | MMIF recombinant protein

Recombinant Human Macrophage migration inhibitory factor

Gene Names
MIF; GIF; GLIF; MMIF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Macrophage migration inhibitory factor; Recombinant Human Macrophage migration inhibitory factor; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12); Phenylpyruvate tautomerase; MMIF recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-115aa; Full Length of Mature Protein
Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Sequence Length
115
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MMIF recombinant protein
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Product Categories/Family for MMIF recombinant protein
References
Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.Weiser W.Y., Temple P.A., Witek-Giannotti J.S., Remold H.G., Clark S.C., David J.R.Proc. Natl. Acad. Sci. U.S.A. 86:7522-7526(1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.3 kDa
NCBI Official Full Name
macrophage migration inhibitory factor
NCBI Official Synonym Full Names
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol
MIF
NCBI Official Synonym Symbols
GIF; GLIF; MMIF
NCBI Protein Information
macrophage migration inhibitory factor
UniProt Protein Name
Macrophage migration inhibitory factor
UniProt Gene Name
MIF
UniProt Synonym Gene Names
GLIF; MMIF; MIF; GIF
UniProt Entry Name
MIF_HUMAN

NCBI Description

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]

Uniprot Description

MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase.

Protein type: Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - phenylalanine; EC 5.3.2.1; Apoptosis; Cytokine; Isomerase; EC 5.3.3.12; Cell development/differentiation

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: cell surface; cytoplasm; extracellular region; extracellular space; myelin sheath; nucleoplasm; vesicle

Molecular Function: chemoattractant activity; cytokine activity; dopachrome isomerase activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; phenylpyruvate tautomerase activity; protein binding; receptor binding

Biological Process: blood coagulation; carboxylic acid metabolic process; cell aging; cell proliferation; cell surface receptor linked signal transduction; DNA damage response, signal transduction by p53 class mediator; inflammatory response; innate immune response; leukocyte migration; negative regulation of apoptosis; negative regulation of cellular protein metabolic process; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of myeloid cell apoptosis; positive chemotaxis; positive regulation of B cell proliferation; positive regulation of cytokine secretion; positive regulation of fibroblast proliferation; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of MAP kinase activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphorylation; prostaglandin biosynthetic process; regulation of macrophage activation

Disease: Rheumatoid Arthritis, Systemic Juvenile

Research Articles on MMIF

Similar Products

Product Notes

The MMIF mif (Catalog #AAA717386) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-115aa; Full Length of Mature Protein. The amino acid sequence is listed below: PMFIVNTNVP RASVPDGFLS ELTQQLAQAT GKPPQYIAVH VVPDQLMAFG GSSEPCALCS LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA. It is sometimes possible for the material contained within the vial of "Macrophage migration inhibitory factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.