Formation of crista junctions protein 1 (FCJ1) Recombinant Protein | FCJ1 recombinant protein
Recombinant Scheffersomyces stipitis Formation of crista junctions protein 1 (FCJ1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Formation of crista junctions protein 1 (FCJ1); Recombinant Scheffersomyces stipitis Formation of crista junctions protein 1 (FCJ1); FCJ1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
14-548aa; full length protein
Sequence
SSSVSETGKSSQGQDQKHENYQNHQQSSLAGIVIKSALFATVVYGATMFIATKNDKVMDF VIDQQIPYYEETIDLIENGSYDDLVSAIKAKISSIRLPSKDEITELSHKIEHTSEDLLKE TKRKLESARAEFGSHSTAGSGTSASLPANQLQKHPEIEHVKKEVEHLPAIKLNENVVSYV DASVKATIDSFNDLINSIDVSKVTPTDEGLIKTINEKVSELASKVGALSKKFDDELQSKL KVSQTELLSSYTKKELELTENLLHQFNRERAQLESKLNERLKQEIAATKETISQAAVNAV SMVRIEQTKNFEKLVADKINEERNGKLANLEKLNSRLESLEQFAESLESQVVATQQKSVI QKSLSSLKAVLFVSNPEEKPQSIKPYVDDLFESSPDDEVIQLALGELGPLLSKESTQSIL TTSQLLTRWEQLVPELRSASLLPPNAGLLGHLASIVFSKFLVSVKGDKPDGKDIESVIGR VEASLVRDELDVAVEEVANLKGWTRKLANDWVIEGRKRLEAEYLVELIDAETRIL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FCJ1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,804 Da
NCBI Official Full Name
Mitochondrial protein of unknown function
NCBI Official Symbol
FMP13
NCBI Protein Information
Mitochondrial protein of unknown function
UniProt Protein Name
MICOS complex subunit MIC60
UniProt Gene Name
MIC60
UniProt Entry Name
MIC60_PICST
Uniprot Description
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a role in keeping cristae membranes connected to the inner boundary membrane. Also promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway ().
Similar Products
Product Notes
The FCJ1 mic60 (Catalog #AAA7014692) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 14-548aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FCJ1 mic60 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSSVSETGKS SQGQDQKHEN YQNHQQSSLA GIVIKSALFA TVVYGATMFI ATKNDKVMDF VIDQQIPYYE ETIDLIENGS YDDLVSAIKA KISSIRLPSK DEITELSHKI EHTSEDLLKE TKRKLESARA EFGSHSTAGS GTSASLPANQ LQKHPEIEHV KKEVEHLPAI KLNENVVSYV DASVKATIDS FNDLINSIDV SKVTPTDEGL IKTINEKVSE LASKVGALSK KFDDELQSKL KVSQTELLSS YTKKELELTE NLLHQFNRER AQLESKLNER LKQEIAATKE TISQAAVNAV SMVRIEQTKN FEKLVADKIN EERNGKLANL EKLNSRLESL EQFAESLESQ VVATQQKSVI QKSLSSLKAV LFVSNPEEKP QSIKPYVDDL FESSPDDEVI QLALGELGPL LSKESTQSIL TTSQLLTRWE QLVPELRSAS LLPPNAGLLG HLASIVFSKF LVSVKGDKPD GKDIESVIGR VEASLVRDEL DVAVEEVANL KGWTRKLAND WVIEGRKRLE AEYLVELIDA ETRIL. It is sometimes possible for the material contained within the vial of "Formation of crista junctions protein 1 (FCJ1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
