Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Major facilitator superfamily domain-containing protein 8 (MFSD8) Recombinant Protein | MFSD8 recombinant protein

Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial

Gene Names
MFSD8; CCMD; CLN7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major facilitator superfamily domain-containing protein 8 (MFSD8); Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8); partial; Ceroid-lipofuscinosis neuronal protein 7; MFSD8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-40aa; Partial
Sequence
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
Sequence Length
153
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for MFSD8 recombinant protein
May be a carrier that transport small solutes by using chemiosmotic ion gradients
References
"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.8 kDa
NCBI Official Full Name
major facilitator superfamily domain-containing protein 8
NCBI Official Synonym Full Names
major facilitator superfamily domain containing 8
NCBI Official Symbol
MFSD8
NCBI Official Synonym Symbols
CCMD; CLN7
NCBI Protein Information
major facilitator superfamily domain-containing protein 8
UniProt Protein Name
Major facilitator superfamily domain-containing protein 8
UniProt Gene Name
MFSD8
UniProt Synonym Gene Names
CLN7

NCBI Description

This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL). [provided by RefSeq, Oct 2008]

Uniprot Description

May be a carrier that transport small solutes by using chemiosmotic ion gradients.

Research Articles on MFSD8

Similar Products

Product Notes

The MFSD8 mfsd8 (Catalog #AAA7095769) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-40aa; Partial. The amino acid sequence is listed below: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. It is sometimes possible for the material contained within the vial of "Major facilitator superfamily domain-containing protein 8 (MFSD8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.