Meteorin-like protein (metrnl) Recombinant Protein | metrnl recombinant protein
Recombinant Xenopus laevis Meteorin-like protein (metrnl)
Gene Names
metrnl.L; metrnl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Meteorin-like protein (metrnl); Recombinant Xenopus laevis Meteorin-like protein (metrnl); metrnl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-286, Full length protein
Sequence
QLYSSDMCNWKGSGLTHEGHTKDVEQVYLRCSEGSVEWLYPTGAMVINLRPNTLTSAYKHLTVCIKPFKDSKGANIYSEKTGELKLVVPDGENNPHKVYCFGLDRGGLYIEATPQQDISRKITGFQYELISQRTLSDLHTVSDPCRPCSDTEVLLAVCISDFVVKGTISAVTNDEELQESLINVTVDKLYRQKSKIFLPKDNGGWEGMIRTPLECGVKTGMGSFLFTGRMHFGEPRLGCTPRYKDFKRIYLEAKKQGLNPCEISTD
Sequence Length
266
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,144 Da
NCBI Official Full Name
meteorin-like protein
NCBI Official Synonym Full Names
meteorin, glial cell differentiation regulator-like L homeolog
NCBI Official Symbol
metrnl.L
NCBI Official Synonym Symbols
metrnl
NCBI Protein Information
meteorin-like protein
UniProt Protein Name
Meteorin-like protein
Protein Family
UniProt Gene Name
metrnl
Uniprot Description
Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy expenditure associated with the browning of the white fat depots and improves glucose tolerance ().
Similar Products
Product Notes
The metrnl metrnl (Catalog #AAA1121822) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-286, Full length protein. The amino acid sequence is listed below: QLYSSDMCNW KGSGLTHEGH TKDVEQVYLR CSEGSVEWLY PTGAMVINLR PNTLTSAYKH LTVCIKPFKD SKGANIYSEK TGELKLVVPD GENNPHKVYC FGLDRGGLYI EATPQQDISR KITGFQYELI SQRTLSDLHT VSDPCRPCSD TEVLLAVCIS DFVVKGTISA VTNDEELQES LINVTVDKLY RQKSKIFLPK DNGGWEGMIR TPLECGVKTG MGSFLFTGRM HFGEPRLGCT PRYKDFKRIY LEAKKQGLNP CEISTD. It is sometimes possible for the material contained within the vial of "Meteorin-like protein (metrnl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
