Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) Recombinant Protein | ML2406 recombinant protein

Recombinant Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable 1; 4-dihydroxy-2-naphthoate octaprenyltransferase (menA); Recombinant Probable 1; 4-dihydroxy-2-naphthoate octaprenyltransferase; DHNA-octaprenyltransferase EC= 2.5.1.74; ML2406 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-294
Sequence
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVALVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVSTVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFFGLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSHKFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALRAMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
Sequence Length
294
Species
Mycobacterium leprae
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,671 Da
NCBI Official Full Name
1,4-dihydroxy-2-naphthoate octaprenyltransferase
NCBI Official Symbol
ML2406
NCBI Protein Information
1,4-dihydroxy-2-naphthoate octaprenyltransferase
UniProt Protein Name
Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase
UniProt Gene Name
menA
UniProt Synonym Gene Names
DHNA-octaprenyltransferase
UniProt Entry Name
MENA_MYCLE

Uniprot Description

Function: Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to dimethylmenaquinone (DMK). Attaches octaprenylpyrophosphate, a membrane-bound 40-carbon side chain to DHNA. The conversion of DHNA to DMK proceeds in three stages: the removal of the carboxyl group of DHNA as CO2, the attachment of the isoprenoid side chain, and a quinol-to-quinone oxidation, which is thought to be spontaneous

By similarity.

Catalytic activity: An all-trans-polyprenyl diphosphate + 1,4-dihydroxy-2-naphthoate = a demethylmenaquinol + diphosphate + CO2.

Pathway: Cofactor biosynthesis; menaquinone biosynthesis; menaquinone-2 from chorismate: step 7/8.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the MenA family.

Similar Products

Product Notes

The ML2406 mena (Catalog #AAA1210851) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-294. The amino acid sequence is listed below: MASFAQWISG ARPRTLPNAV APVVAGTGTA AWLHSAVWWK ALLALVVAVA LVIGVNYAND YSDGIRGTDD HRAGPMRLVG SRLAFPRSVL TAAVVGLTVS TVAGLALALL SAPWLIMVGA TCIAGAWLYT GSSKPYGYKG FGEVAVFVFF GLVAVLGTEY TQALRVDWVG LVLAVSTGAL SSSVLVANNL RDIHTDTQSH KFTLAVRLGD AHTRQLYQAL LVATGVLTVV LMVATSWCAV GLVATPLALR AMRPVRSGRM GPDLTPVLRD TGLAMVVWAI AVAGALTLAG SVTY. It is sometimes possible for the material contained within the vial of "Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual